[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39943.1
DDBJ      :             Serine-type D-Ala-D-Ala carboxypeptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  673/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.105.1e.3.1
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->408 1z6fA PDBj 2e-50 34.5 %
:RPS:PDB   56->321 2bcfA PDBj 1e-39 23.3 %
:RPS:SCOP  69->314 1hd8A2  e.3.1.1 * 2e-77 40.4 %
:RPS:SCOP  316->408 1hd8A1  b.105.1.1 * 1e-14 17.2 %
:HMM:SCOP  27->316 1tvfA2 e.3.1.1 * 6.2e-76 37.2 %
:HMM:SCOP  316->408 1hd8A1 b.105.1.1 * 1.8e-16 32.3 %
:RPS:PFM   65->294 PF00768 * Peptidase_S11 5e-50 46.0 %
:RPS:PFM   316->402 PF07943 * PBP5_C 3e-05 28.7 %
:HMM:PFM   69->293 PF00768 * Peptidase_S11 1.8e-66 45.5 224/241  
:HMM:PFM   316->402 PF07943 * PBP5_C 1.9e-14 28.7 87/91  
:BLT:SWISS 72->384 DACA_HAEIN 2e-55 39.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39943.1 GT:GENE ABE39943.1 GT:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3029324..3030622 GB:FROM 3029324 GB:TO 3030622 GB:DIRECTION + GB:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GB:PROTEIN_ID ABE39943.1 GB:DB_XREF GI:91683641 InterPro:IPR001967 InterPro:IPR012907 LENGTH 432 SQ:AASEQ MVRAPVESRSGTHFMALFAPLLPVRSRRLRGWRVLLAGVLAMAIGSGAVYAANQSVQGAKKEEVAGGYETEAPTAILIDAESGSVLFEKNADELRPPSSMLKLMTVELVFHLLTKGEIKLTDDYRISENAWRRGGAPAGSSTMFAEIHSRVSIDDLLRGAIIQSGNDSCIALAEGIAGSEQAFAERMTKRAREIGLAQSTFANSNGLPDPGNKMSVRELGRLARHLIQTYPDYYKLFGEKEFTWNKIRQTNRNPLLNTMPGADGLKTGYTKDGGYGMVGSAVQNGTRLIVVVNGVEDADDRASEAKKLLEWGFRNFESRPLFAAQATVGYARVFGGEKRYVGLTPVEPVRVMVRKNGSDKLLARIVYTGPIAAPVEAGHRIGVVRVWRGPNLAVEVPLQAAEVNPVGSTMRRALDGASELMIGVFRAGIAKL GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 72->384|DACA_HAEIN|2e-55|39.9|311/393| TM:NTM 1 TM:REGION 31->53| BL:PDB:NREP 1 BL:PDB:REP 61->408|1z6fA|2e-50|34.5|348/354| RP:PDB:NREP 1 RP:PDB:REP 56->321|2bcfA|1e-39|23.3|249/255| RP:PFM:NREP 2 RP:PFM:REP 65->294|PF00768|5e-50|46.0|226/235|Peptidase_S11| RP:PFM:REP 316->402|PF07943|3e-05|28.7|87/91|PBP5_C| HM:PFM:NREP 2 HM:PFM:REP 69->293|PF00768|1.8e-66|45.5|224/241|Peptidase_S11| HM:PFM:REP 316->402|PF07943|1.9e-14|28.7|87/91|PBP5_C| GO:PFM:NREP 4 GO:PFM GO:0006508|"GO:proteolysis"|PF00768|IPR001967| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF00768|IPR001967| GO:PFM GO:0006508|"GO:proteolysis"|PF07943|IPR012907| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF07943|IPR012907| RP:SCP:NREP 2 RP:SCP:REP 69->314|1hd8A2|2e-77|40.4|230/243|e.3.1.1| RP:SCP:REP 316->408|1hd8A1|1e-14|17.2|93/94|b.105.1.1| HM:SCP:REP 27->316|1tvfA2|6.2e-76|37.2|277/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| HM:SCP:REP 316->408|1hd8A1|1.8e-16|32.3|93/94|b.105.1.1|1/1|Penicillin-binding protein associated domain| OP:NHOMO 1510 OP:NHOMOORG 677 OP:PATTERN -------------------------------------------------------------------- 1---21-1111-1-21111-121111111111111111111111----------------11--111441--------11-11-----------------------------------------1111-11111-1---------3---------------------------------------------33388888998898899834443389933344222222224411111111111111121-2111411112111221111121-221112222222211111111111112222222222222211111111334344444444443444553343445225242366554234233333-12-1-111123333333333333333344444343444-333333334422444455455544332222222222222222222222222232211111111----11111111111111111111211222231112111444411215555332221111-12222222222232212122211222222221122211-----1-22-111-1-1---1--------121--------------------1---33232111111111111122122211211111--11111------33223434444434443-44544444444444444433333222233323333333232233234322321333334333333--11111111111211211111-11111-11-13333333112112222111111111211111111111111114333333322222111111111111111-------1111111111------------------------------------212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 92.8 SQ:SECSTR ##################cTTccTTcccTTTTHHTTcGGGTccccHHHHHHHcHccccTTcccHHHcccccccEEEEEETTTcEEEEEEcTTcccccGGGHHHHHHHHHHHHccTTcEEEccTGGGccccccHHTcccTTTTccccTTcEEEHHHHHHHHHHcccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHTcTTcccccccccTTccccccHHHHHHHHHHHHccHHHHHHHHccEEEccccEEEEcccTHHHHcTTEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEcccTcccHHHHHHHHHHHHHHccTTcccEccccEEEEETTEEEEEEEEEETTEEEEEEEETTTcEcHTcEEEEEEcEEcccTTcHHHHTTHHHHHcccccccccTTEEEETTEEEETTcccccccc############# DISOP:02AL 1-7| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHccccccccEEEEccccEEEHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEccccccccccEEcHHHHHHHHHHHHHHcHHHHHHHcccEEEEccEEEEEEcccccccccccEEEEEEcccccEEEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEccccEEEEEEccccccEEEEEEEccccccccccccEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcc //