[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39958.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39958.1 GT:GENE ABE39958.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3050291..3050611 GB:FROM 3050291 GB:TO 3050611 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39958.1 GB:DB_XREF GI:91683656 LENGTH 106 SQ:AASEQ MVADQAPPALHCEVDANVNGDHVTLRGLITAVRGGAGSYTLMVKKSGASGTSTIKQAGGFNTQADQSVSVGSVVLDYQNGTRYTAELDVSFEGAVFKCDLAPRSLK GT:EXON 1|1-106:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,46-59,106-107| PSIPRED ccccccccEEEEEEEEccccccEEEEEEEEEEcccccEEEEEEEEEccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEEEEEEccEEEEEEccHHHcc //