[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39966.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->69 PF11911 * DUF3429 0.00026 21.4 42/142  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39966.1 GT:GENE ABE39966.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3055256..3055531) GB:FROM 3055256 GB:TO 3055531 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39966.1 GB:DB_XREF GI:91683664 LENGTH 91 SQ:AASEQ MYSPTQDQAARANHTFCAIVENRMSMDKRTNLIGDAIVIAAGWIAFFVLSGSPEAQVMALLFFGLGLVVRRSAGRASQSTSAQVETALASS GT:EXON 1|1-91:0| TM:NTM 2 TM:REGION 30->50| TM:REGION 56->70| HM:PFM:NREP 1 HM:PFM:REP 25->69|PF11911|0.00026|21.4|42/142|DUF3429| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,73-84,90-92| PSIPRED cccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcc //