[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39967.1
DDBJ      :             Histone-like nucleoid-structuring protein H-NS
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.155.1
:139 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  81->128 1hnrA  a.155.1.1 * 8e-08 37.8 %
:HMM:SCOP  84->129 1hnrA_ a.155.1.1 * 7.3e-10 45.7 %
:RPS:PFM   87->131 PF10521 * DUF2454 7e-04 47.4 %
:HMM:PFM   33->121 PF00816 * Histone_HNS 1.3e-13 28.1 89/93  
:BLT:SWISS 21->127 HVRA_RHOCA 1e-07 28.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39967.1 GT:GENE ABE39967.1 GT:PRODUCT Histone-like nucleoid-structuring protein H-NS GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3055950..3056369) GB:FROM 3055950 GB:TO 3056369 GB:DIRECTION - GB:PRODUCT Histone-like nucleoid-structuring protein H-NS GB:PROTEIN_ID ABE39967.1 GB:DB_XREF GI:91683665 InterPro:IPR001801 LENGTH 139 SQ:AASEQ MNRNRSADLIPSRWEGAVKDIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRLRLGVTSGANQQSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGKSIDDFLIRAKPSNVRKKRR GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 21->127|HVRA_RHOCA|1e-07|28.0|100/102| RP:PFM:NREP 1 RP:PFM:REP 87->131|PF10521|7e-04|47.4|38/272|DUF2454| HM:PFM:NREP 1 HM:PFM:REP 33->121|PF00816|1.3e-13|28.1|89/93|Histone_HNS| RP:SCP:NREP 1 RP:SCP:REP 81->128|1hnrA|8e-08|37.8|45/47|a.155.1.1| HM:SCP:REP 84->129|1hnrA_|7.3e-10|45.7|46/0|a.155.1.1|1/1|H-NS histone-like proteins| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2-2--1---------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,45-46,48-53,69-91,131-140| PSIPRED ccccccccccHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccccccccccccEEEccccccccccccccccHHHHHHHHccccHHHHHHcccHHHHHcccc //