[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39980.1
DDBJ      :             MazG family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  527/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1a.7.7
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->271 3crcA PDBj 4e-34 40.3 %
:RPS:PDB   6->271 3crcA PDBj 3e-45 42.8 %
:RPS:SCOP  1->89 1y6xA1  a.204.1.4 * 3e-07 9.0 %
:RPS:SCOP  172->250 1ugoA  a.7.7.1 * 8e-17 16.5 %
:HMM:SCOP  3->110 2gtaD1 a.204.1.2 * 1.1e-23 35.0 %
:HMM:SCOP  148->249 2gtaD1 a.204.1.2 * 2.4e-25 47.0 %
:RPS:PFM   181->237 PF03819 * MazG 9e-11 52.6 %
:HMM:PFM   30->103 PF03819 * MazG 1e-30 54.1 74/74  
:HMM:PFM   176->237 PF03819 * MazG 7.4e-11 30.6 62/74  
:BLT:SWISS 7->271 MAZG_HAEIN 2e-47 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39980.1 GT:GENE ABE39980.1 GT:PRODUCT MazG family protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3072422..3073258 GB:FROM 3072422 GB:TO 3073258 GB:DIRECTION + GB:PRODUCT MazG family protein GB:PROTEIN_ID ABE39980.1 GB:DB_XREF GI:91683678 InterPro:IPR004518 InterPro:IPR011551 LENGTH 278 SQ:AASEQ MTPSRDIARLLEIMAQLRTPETGCPWDLEQDFATIAPYTIEEAFEVAEAIARNDLDDLREELGDLLLQVVFHARIAEERGAFAFGDVVEAVTRKMIRRHPHVFTDSEGRLAPSHVEGVWDRIKAEEKAERAARRGEPVASQSSVLAGVKAGQPALSRAMELQRKASKVGFDWNDPREVLKKIREEADEIEVALDRGDKDHIAEETGDLMFALVNLARHTGADPEMALRGTNAKFERRFSYIEQALAARGKSPDTATLAEMDALWDEAKRAETPGENQR GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 7->271|MAZG_HAEIN|2e-47|39.4|254/263| SEG 40->51|ieeafevaeaia| SEG 54->67|dlddlreelgdlll| SEG 121->136|rikaeekaeraarrge| BL:PDB:NREP 1 BL:PDB:REP 7->271|3crcA|4e-34|40.3|221/225| RP:PDB:NREP 1 RP:PDB:REP 6->271|3crcA|3e-45|42.8|222/225| RP:PFM:NREP 1 RP:PFM:REP 181->237|PF03819|9e-11|52.6|57/67|MazG| HM:PFM:NREP 2 HM:PFM:REP 30->103|PF03819|1e-30|54.1|74/74|MazG| HM:PFM:REP 176->237|PF03819|7.4e-11|30.6|62/74|MazG| RP:SCP:NREP 2 RP:SCP:REP 1->89|1y6xA1|3e-07|9.0|85/87|a.204.1.4| RP:SCP:REP 172->250|1ugoA|8e-17|16.5|79/99|a.7.7.1| HM:SCP:REP 3->110|2gtaD1|1.1e-23|35.0|100/0|a.204.1.2|1/2|all-alpha NTP pyrophosphatases| HM:SCP:REP 148->249|2gtaD1|2.4e-25|47.0|100/0|a.204.1.2|2/2|all-alpha NTP pyrophosphatases| OP:NHOMO 528 OP:NHOMOORG 527 OP:PATTERN -------------------------------------------------------------------- 111-1-----------------------------------1-1111-11111--1--------1-111111-------1111-111111111-1111--11111111111---------------11111111111111-1111111111111111111111111111111-1111-11111-1--111111111111111111111111111111111111111------11------------------1-----------------------------------------------------------------------11111111111111111111111-11--1--11111111111111111--11-1111-11-11111111111111111111111-1-11111111111-1111111111111111111111111111111111111111111------------------------------11111-----------------------------------------------------------------------1111-111111111-11111111111111111---------------------------111111111111111111111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------1111111111111111111111111111111111111111111111111----------1111111111111111111111111111--11111111--------11--------------------------1111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 92.4 SQ:SECSTR cccHHcHHHHHHHHHHHHccccccTTTTcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHccccccccccccccccHHHHHHcEEcT##############TccccccTTccccTTccHHHHHHHHHHHHHTTTcccccHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccTTHHHHHHHHHHHc####### DISOP:02AL 1-3,124-147,266-279| PSIPRED ccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHcccccc //