[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39993.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->94 1xo4A PDBj 7e-05 33.8 %
:RPS:PDB   27->73 3efaA PDBj 6e-04 17.0 %
:RPS:SCOP  10->94 1r57A  d.108.1.1 * 4e-22 24.7 %
:HMM:SCOP  7->96 1xmtA_ d.108.1.1 * 1.6e-23 46.6 %
:HMM:PFM   27->73 PF00583 * Acetyltransf_1 3.7e-06 27.7 47/83  
:BLT:SWISS 10->89 GTL3B_MOUSE 4e-08 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39993.1 GT:GENE ABE39993.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3084726..3085016 GB:FROM 3084726 GB:TO 3085016 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39993.1 GB:DB_XREF GI:91683691 LENGTH 96 SQ:AASEQ MNGTTTAAGVRNNKAMNRFELDSHGEVAFANYRRANGRVIITHTETPEPLRGRGIASRLVRGALDLIRAEGLKVTAGCGFVADYLDTHPEYADLTR GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 10->89|GTL3B_MOUSE|4e-08|32.5|80/110| BL:PDB:NREP 1 BL:PDB:REP 13->94|1xo4A|7e-05|33.8|80/103| RP:PDB:NREP 1 RP:PDB:REP 27->73|3efaA|6e-04|17.0|47/143| HM:PFM:NREP 1 HM:PFM:REP 27->73|PF00583|3.7e-06|27.7|47/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 10->94|1r57A|4e-22|24.7|85/102|d.108.1.1| HM:SCP:REP 7->96|1xmtA_|1.6e-23|46.6|88/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 80 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ----1----------------1---1------1111-221-1---111-11-----------11--1-111-----------------2111------------1------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112-----1121121211111--------------1--1-1-------------------1--------------------11-------------------------------------1--11111---------------------------------1--------2-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112---------------1---------------------------111-1------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 85.4 SQ:SECSTR ############ETTTTEEEcTTcEEEEEEEEEEccTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTTccTTccccccEEEEEEETTcTTT## DISOP:02AL 1-4,93-93| PSIPRED ccccccccEEEEEccccEEEEEEccEEEEEEEEEcccEEEEEEEEccHHHccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHcccHHHHcc //