[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40000.1
DDBJ      :             protein of unknown function DUF1127
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->40 PF06568 * DUF1127 4e-04 60.5 %
:HMM:PFM   4->42 PF06568 * DUF1127 1.6e-17 66.7 39/40  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40000.1 GT:GENE ABE40000.1 GT:PRODUCT protein of unknown function DUF1127 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3090031..3090183 GB:FROM 3090031 GB:TO 3090183 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF1127 GB:PROTEIN_ID ABE40000.1 GB:DB_XREF GI:91683698 InterPro:IPR009506 LENGTH 50 SQ:AASEQ MLLSLIRALRAFRDYQRNLAELSQLSDRELADIGLDRSDIPRVASGHYHG GT:EXON 1|1-50:0| RP:PFM:NREP 1 RP:PFM:REP 3->40|PF06568|4e-04|60.5|38/40|DUF1127| HM:PFM:NREP 1 HM:PFM:REP 4->42|PF06568|1.6e-17|66.7|39/40|DUF1127| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,45-51| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHcccccc //