[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40009.1
DDBJ      :             peptidase M23B
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  715/915 : Eukaryota  6/199 : Viruses  9/175   --->[See Alignment]
b.84.3d.7.1
:478 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   350->473 2gu1A PDBj 4e-17 38.1 %
:RPS:PDB   153->203 2djpA PDBj 1e-08 29.4 %
:RPS:PDB   235->279 2djpA PDBj 1e-07 24.4 %
:RPS:PDB   359->475 2b44A PDBj 4e-25 30.8 %
:RPS:SCOP  152->198 1e0gA  d.7.1.1 * 1e-08 31.1 %
:RPS:SCOP  239->272,356->475 1qwyA  b.84.3.2 * 4e-26 32.2 %
:HMM:SCOP  151->200 1e0gA_ d.7.1.1 * 1.7e-07 45.8 %
:HMM:SCOP  231->475 1qwyA_ b.84.3.2 * 9e-48 32.2 %
:RPS:PFM   379->464 PF01551 * Peptidase_M23 3e-21 51.8 %
:HMM:PFM   376->471 PF01551 * Peptidase_M23 3.4e-32 47.4 95/96  
:HMM:PFM   157->198 PF01476 * LysM 8.6e-12 39.0 41/44  
:HMM:PFM   235->278 PF01476 * LysM 3.8e-13 39.5 43/44  
:BLT:SWISS 156->278 YAAH_BACSU 4e-07 39.1 %
:BLT:SWISS 358->475 YGER_ECOLI 3e-28 47.0 %
:REPEAT 2|157->198|237->278
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40009.1 GT:GENE ABE40009.1 GT:PRODUCT peptidase M23B GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3099495..3100931) GB:FROM 3099495 GB:TO 3100931 GB:DIRECTION - GB:PRODUCT peptidase M23B GB:PROTEIN_ID ABE40009.1 GB:DB_XREF GI:91683707 InterPro:IPR002482 InterPro:IPR002886 LENGTH 478 SQ:AASEQ MSRVVELLCSRRAPQMAVLTLISVGFSACSADMQTRFQQAPFGPVETTGSVQQPRYGERRELPQYARPQYQSAQPQYQPAQPQYQSQALPPIAAPPSYPVAGGGSGVSSGGRGVASYEPPQRAPIETTGTVAPRSVAAARPAPAPAAVPASGTTIIVGTSDTLEGLARRYNVATADILQANGYKGPRRLQPGQSLVIPQRTASLQAPVAAPPVARPLAAAPAPMPVAAAAPPRVHYVNSGDTLMNIARRNNISAAELARYNRIDANARLQPGMKINVPGAQSAALAAPPLAAPATAQPAAQPAVSAAPPVRMAVAAPADPVQKARMVAPTETPAAAEPAEASPVKSAEATGALPSFRWPVRGRVITAYGAKTNGKSNDGINLAVPEGTPVKAAEDGVVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSPQLHFEIRKGSSPVDPLKFLNGA GT:EXON 1|1-478:0| BL:SWS:NREP 2 BL:SWS:REP 156->278|YAAH_BACSU|4e-07|39.1|92/100| BL:SWS:REP 358->475|YGER_ECOLI|3e-28|47.0|115/251| NREPEAT 1 REPEAT 2|157->198|237->278| SEG 63->91|pqyarpqyqsaqpqyqpaqpqyqsqalpp| SEG 93->116|aappsypvagggsgvssggrgvas| SEG 132->151|aprsvaaarpapapaavpas| SEG 206->234|apvaappvarplaaapapmpvaaaapprv| SEG 280->321|aqsaalaapplaapataqpaaqpavsaappvrmavaapadpv| SEG 327->349|vaptetpaaaepaeaspvksaea| BL:PDB:NREP 1 BL:PDB:REP 350->473|2gu1A|4e-17|38.1|113/324| RP:PDB:NREP 3 RP:PDB:REP 153->203|2djpA|1e-08|29.4|51/77| RP:PDB:REP 235->279|2djpA|1e-07|24.4|45/77| RP:PDB:REP 359->475|2b44A|4e-25|30.8|117/129| RP:PFM:NREP 1 RP:PFM:REP 379->464|PF01551|3e-21|51.8|85/96|Peptidase_M23| HM:PFM:NREP 3 HM:PFM:REP 376->471|PF01551|3.4e-32|47.4|95/96|Peptidase_M23| HM:PFM:REP 157->198|PF01476|8.6e-12|39.0|41/44|LysM| HM:PFM:REP 235->278|PF01476|3.8e-13|39.5|43/44|LysM| RP:SCP:NREP 2 RP:SCP:REP 152->198|1e0gA|1e-08|31.1|45/48|d.7.1.1| RP:SCP:REP 239->272,356->475|1qwyA|4e-26|32.2|152/234|b.84.3.2| HM:SCP:REP 151->200|1e0gA_|1.7e-07|45.8|48/48|d.7.1.1|1/2|LysM domain| HM:SCP:REP 231->475|1qwyA_|9e-48|32.2|245/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 2400 OP:NHOMOORG 730 OP:PATTERN -------------------------------------------------------------------- 111-13132221-111111-151111111111212267871--1-1-1-231332111--221-222655-------------31522454435112--2223532123----------------2124254323311111---22D534343433312233213456664-3-----3----42232222-214444533335344433222124442-141241-----72-112111-1211112---112----------------------12-111-----------------------------------------433--11111111113-11-454115-1721647536445434665531-33-555322222223344343433333333333334-335435333452433333333333323344211111221---------11--44422-11-------22222222212212122256453555566666665455455665555366563444222223344432334344334444422222223434444342344556344353632434445565823-1113333332333333333333222116534435455466666656656656666651-2445511-11144333434444444444-4444444444444444444545333334444444444444444444344443143333333333322342222244441554533333333322333333333321115577774545655555455---------3556776676777556665655666555511448888783442432355--------------------------2211112111--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------6--1--1--1---- -1--------------------------------------------------------------------------------1---------------------11---1----------------1-------111-------------------------------------- STR:NPRED 224 STR:RPRED 46.9 SQ:SECSTR #######################################################################################################################################################cEEEcccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccEEEEEEccc###############################EcccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccEEEEE######################################################################EcccccTcTccTHHHHTccEEEccEEEEccEEEEccTTcEEEccccEEEEEEEEccccccEEEEEEETTcEEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEcGGEEccHHHHc## DISOP:02AL 1-1,48-86,333-350,478-479| PSIPRED cHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccHHHHcHHHccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHcccHHHHHHHcccccccEEEcccEEEEccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHcccHHHHHHHcccccccEEEcccEEEEccccccccccccccccccccccccccccccccEEEEEcccccccccEEccccccccccccccccccccccHHccccccccccccccEEccccccccccccccEEEccccccEEEEccccEEEEEEcccccccEEEEEEccccEEEEEEEccccccccccEEEcccEEEEEEccccccccEEEEEEEEccEEEcHHHHHccc //