[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40013.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->68 PF00839 * Cys_rich_FGFR 0.00017 13.5 37/58  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40013.1 GT:GENE ABE40013.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3103399..3103677 GB:FROM 3103399 GB:TO 3103677 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40013.1 GB:DB_XREF GI:91683711 LENGTH 92 SQ:AASEQ MTATRTSMIRRIALSLIVVAMLPATSTASFAYSSEAAQMCTDDAFKLCASEIPSIPKITACMRSNRTKLSTGCRAVMDRDLAAEKAHKVAAQ GT:EXON 1|1-92:0| HM:PFM:NREP 1 HM:PFM:REP 32->68|PF00839|0.00017|13.5|37/58|Cys_rich_FGFR| OP:NHOMO 15 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------312-1---121--------------1--21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,75-93| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHcccHHHHHHHHHHccHHccHHHHHHHHccccHHHHcHHHcc //