[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40016.1
DDBJ      :             Sec-independent protein translocase TatC
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  674/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:267 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->232 PF00902 * TatC 1e-38 43.5 %
:HMM:PFM   14->232 PF00902 * TatC 3.3e-73 47.4 213/214  
:BLT:SWISS 1->242 TATC_AZOCH 3e-38 40.4 %
:PROS 165->184|PS01218|TATC
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40016.1 GT:GENE ABE40016.1 GT:PRODUCT Sec-independent protein translocase TatC GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3105827..3106630) GB:FROM 3105827 GB:TO 3106630 GB:DIRECTION - GB:PRODUCT Sec-independent protein translocase TatC GB:PROTEIN_ID ABE40016.1 GB:DB_XREF GI:91683714 InterPro:IPR002033 LENGTH 267 SQ:AASEQ MSAEDIEASKAPLMDHLIELRSRLIKALLGFGIAFIFCFFFAKQIYNVLVWPFVWVAGAENSKFIYTALLEYFLTQLKLAMFGAGFISFPIIATQIYKFVAPGLYKHEKNAFLPYLVATPVFFVLGSLLVYFIVLPMLVRFSLGMQQMGGDETAQIQLLPKVGEYLSLMMSLIFAFGLAFQLPVILTLLGRIGVLTSKQLREKRRYFIVGAFVIAAVLTPPDVISQMSLALPLMVLYEGSIYAVAIVEKNLKAKAATAEASDSKPAE GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 1->242|TATC_AZOCH|3e-38|40.4|235/255| PROS 165->184|PS01218|TATC|PDOC00936| TM:NTM 6 TM:REGION 27->49| TM:REGION 74->96| TM:REGION 118->140| TM:REGION 172->194| TM:REGION 207->229| TM:REGION 231->252| SEG 28->42|llgfgiafifcfffa| RP:PFM:NREP 1 RP:PFM:REP 14->232|PF00902|1e-38|43.5|214/215|TatC| HM:PFM:NREP 1 HM:PFM:REP 14->232|PF00902|3.3e-73|47.4|213/214|TatC| OP:NHOMO 769 OP:NHOMOORG 715 OP:PATTERN ------11-------11111111221112-12------------------222--------1111-11 11211-1-111111-11----1--11-----1111111--111111111111111-11--11111111111-------11111111111111-1-----11111112111---------------11111111111111-11111111111111111-11--1111111111-11111-111111111---11211111111111111112221211111121111-11--131111111111111111--1----------------------------------1--------------------------1--111-----11--------------------1----1--111111111111------11111111-1111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111113111111111111121111-11111111111111111111111111111111111111111212111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111111111111111111111111121121211111111122221111---------11111111111111111111111111111111-----11----------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------11H111113114--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,10-10,248-268| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccccccccc //