[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40018.1
DDBJ      :             twin-arginine translocation protein, TatA/E family
Swiss-Prot:TATA_RHOPS   RecName: Full=Sec-independent protein translocase protein tatA/E homolog;

Homologs  Archaea  0/68 : Bacteria  93/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->53 PF02416 * MttA_Hcf106 4.9e-14 28.0 50/53  
:BLT:SWISS 1->79 TATA_RHOPS 5e-42 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40018.1 GT:GENE ABE40018.1 GT:PRODUCT twin-arginine translocation protein, TatA/E family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3107435..3107674) GB:FROM 3107435 GB:TO 3107674 GB:DIRECTION - GB:PRODUCT twin-arginine translocation protein, TatA/E family GB:PROTEIN_ID ABE40018.1 GB:DB_XREF GI:91683716 InterPro:IPR003369 InterPro:IPR006312 LENGTH 79 SQ:AASEQ MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSIDHNAPTAAAPTRTDVGSKAV GT:EXON 1|1-79:0| SW:ID TATA_RHOPS SW:DE RecName: Full=Sec-independent protein translocase protein tatA/E homolog; SW:GN Name=tatA; OrderedLocusNames=RPD_2790; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Protein transport; Translocation; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|TATA_RHOPS|5e-42|100.0|79/79| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0055085|"GO:transmembrane transport"|Translocation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 1->22| HM:PFM:NREP 1 HM:PFM:REP 4->53|PF02416|4.9e-14|28.0|50/53|MttA_Hcf106| OP:NHOMO 93 OP:NHOMOORG 93 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11111111111111111111111-1111111111--11111111111111---------------------1---1--1--------------------------------111-1111-1111-1111111111111111--1-1---------111-----11--------------11---1-----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,42-80| PSIPRED cccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc //