[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40026.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.6
:339 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  63->198 1p0zA_ d.110.6.1 * 1.6e-19 31.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40026.1 GT:GENE ABE40026.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3116405..3117424 GB:FROM 3116405 GB:TO 3117424 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40026.1 GB:DB_XREF GI:91683724 LENGTH 339 SQ:AASEQ MSMSVTSEVSQRPRPLTGLRVGLITALVLSLLFGAMIAITFSMQNEVIAHDRDNQMGAISQAITAALDQAGRFALTQAETTARQAAVARALAAGDRAALSELAGGTYAYLKTQGVPVFGFHAADMTYLLRLHLPDKFGDDLTKIRPMVLAANKTGRSQVGLEIGIAGTFVRGIAVVRDGDRFVGTVETGLNLEPILEQVKALTNADIAVVLSQSLADLPPRGASQNGAGETFGDLMALASTDTQLFNGLLRDGAIRLTRTRDVSAHQLQGGSAAVLVQPLIDFSGRMIGNIAAVKTFPAHGAALQRTRTELIAAAMIGAILAFVAFSVLARMIAMRGQS GT:EXON 1|1-339:0| TM:NTM 2 TM:REGION 21->43| TM:REGION 311->333| SEG 74->99|altqaettarqaavaralaagdraal| SEG 312->325|iaaamigailafva| HM:SCP:REP 63->198|1p0zA_|1.6e-19|31.5|130/0|d.110.6.1|1/1|Sensory domain-like| OP:NHOMO 30 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------1-------------11---11121----------------------------------------------------------------3---------------------------------------------------------------------------------------------------------1------1--------1---11----------------------------------------------------1111-1-1--1-1--1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,338-340| PSIPRED ccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEEEEEEEEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHccEEEEEEcccHHHHccccccccccccccccHHHcccccccccHHHHHcccHHHHHccccccEEEccccEEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //