[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40053.1
DDBJ      :             protein translocase subunit secG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->72 PF03840 * SecG 2.4e-23 45.1 71/74  
:BLT:SWISS 1->99 SECG_ECOLI 2e-07 32.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40053.1 GT:GENE ABE40053.1 GT:PRODUCT protein translocase subunit secG GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3147373..3147759) GB:FROM 3147373 GB:TO 3147759 GB:DIRECTION - GB:PRODUCT protein translocase subunit secG GB:PROTEIN_ID ABE40053.1 GB:DB_XREF GI:91683751 InterPro:IPR004692 LENGTH 128 SQ:AASEQ MQTVIIVIHLMLVLGLIGSVLLQKSEGGGLGVGGGGGGGFMSSRGTANLLTRTTAILAAGFFVTSLLLSWLATYNRKPTMLPTSVPTQQSPATPVPPVSQGGGLLDTLKQTDQQQNQQPAAPSPPRSQ GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 1->99|SECG_ECOLI|2e-07|32.3|99/110| TM:NTM 2 TM:REGION 4->26| TM:REGION 51->72| SEG 27->39|ggglgvggggggg| SEG 113->127|qqqnqqpaapspprs| HM:PFM:NREP 1 HM:PFM:REP 2->72|PF03840|2.4e-23|45.1|71/74|SecG| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111111111111111--------------11------1---1---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,76-129| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccc //