[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40057.1
DDBJ      :             indole-3-glycerol phosphate synthase
Swiss-Prot:TRPC_RHOPS   RecName: Full=Indole-3-glycerol phosphate synthase;         Short=IGPS;         EC=4.1.1.48;

Homologs  Archaea  58/68 : Bacteria  732/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->253 1piiA PDBj 4e-36 41.1 %
:RPS:PDB   4->252 3b5vA PDBj 2e-25 25.2 %
:RPS:SCOP  40->252 1a53A  c.1.2.4 * 2e-75 32.4 %
:HMM:SCOP  11->265 1i4nA_ c.1.2.4 * 2.7e-96 56.4 %
:RPS:PFM   5->252 PF00218 * IGPS 1e-60 55.1 %
:HMM:PFM   4->260 PF00218 * IGPS 6.3e-100 54.5 255/255  
:BLT:SWISS 1->253 TRPC_RHOPS e-127 100.0 %
:PROS 56->74|PS00614|IGPS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40057.1 GT:GENE ABE40057.1 GT:PRODUCT indole-3-glycerol phosphate synthase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3151970..3152767 GB:FROM 3151970 GB:TO 3152767 GB:DIRECTION + GB:PRODUCT indole-3-glycerol phosphate synthase GB:PROTEIN_ID ABE40057.1 GB:DB_XREF GI:91683755 InterPro:IPR001468 InterPro:IPR003009 LENGTH 265 SQ:AASEQ MSDILNKIEAYKREEIAAAKRERPLAALQAAARAAPPPRGFVSALRAKLADGDYALIAEIKKASPSKGLIRPDFDPPALAKAYQQGGAACLSVLTDTPSFQGHLDYLVAARAAVSLPALRKDFMYDTYQVVEARAHGADCILIIMAALDDSEARDIEDAALDLGMDVLLEVHNHAELDRALALRSPMIGVNNRNLRTFEVTLATSEALAPLIPSDRLMVGESGIFTPDDLARLARVGMSTFLVGESLMRQQDVAAATRTLLARAA GT:EXON 1|1-265:0| SW:ID TRPC_RHOPS SW:DE RecName: Full=Indole-3-glycerol phosphate synthase; Short=IGPS; EC=4.1.1.48; SW:GN Name=trpC; OrderedLocusNames=RPD_2829; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Decarboxylase; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->253|TRPC_RHOPS|e-127|100.0|253/265| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016831|"GO:carboxy-lyase activity"|Decarboxylase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| PROS 56->74|PS00614|IGPS|PDOC00536| SEG 21->39|rerplaalqaaaraapppr| SEG 254->264|aaatrtllara| BL:PDB:NREP 1 BL:PDB:REP 55->253|1piiA|4e-36|41.1|197/452| RP:PDB:NREP 1 RP:PDB:REP 4->252|3b5vA|2e-25|25.2|238/247| RP:PFM:NREP 1 RP:PFM:REP 5->252|PF00218|1e-60|55.1|245/253|IGPS| HM:PFM:NREP 1 HM:PFM:REP 4->260|PF00218|6.3e-100|54.5|255/255|IGPS| RP:SCP:NREP 1 RP:SCP:REP 40->252|1a53A|2e-75|32.4|210/247|c.1.2.4| HM:SCP:REP 11->265|1i4nA_|2.7e-96|56.4|250/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 957 OP:NHOMOORG 909 OP:PATTERN 11-1--1111111111-111111111111111111111111111111111111111--1--111--11 1111122111111111111-11111111111111111111111111111111111111--1111111121111111-1----111111111111---111-111111111--------11-----11111111111111111111111211111111111111111123311111111111111111111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------11111111111111-------------1--111----11-11----------1-11----1-1--11111112111--111111--11111111-----221111111111111111111111-11111111111-1111111111111211111111111111111111111111111-----------------------------11111111111111211111111111111111111111111112111111111111111111111111111111111-11111111111111111111111111111211111111111-1111111111111111111111111111111111111111111111--1111111-1111111111111-111111-1111111111111111111111111111111111111111111111111111-11111111111111-111-11111111111111111-11111-111111111111111111111111111111211111111111111111111111111111111111111111-111111--------------------------------------1--1-111112 ------1-----1111111-111121111111111111-1111111111111111111111111111111111111111111111111-13112121111111111-12------------------------------------------------------1-----------111191111223421232211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 94.3 SQ:SECSTR ###cccHHHHHHHHHHHTcccccccccccccHHHHHHHHcHHHHHHHHHHTTcccEEEEEccccTTccEEEcccccHHHHHHHHTTTccEEEEEcccTTTcccHHHHHHHHTTccccEEEEcccccTHHHHHHHHHTccEEEEETTTccHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHTTccEEEEEcccTTTcccccTTHHHHHHHccTTcEEEEEcccccHHHHHHHHHTTccEEEEcHHHHHcTTc############ DISOP:02AL 32-32,265-266| PSIPRED cccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccEEEEEHHHccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHccccEEEEcHHHcccHHHHHHHHHHHHHcc //