[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40075.1
DDBJ      :             3-hydroxyacyl-[acyl-carrier-protein] dehydratase
Swiss-Prot:FABZ_RHOPS   RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;         Short=(3R)-hydroxymyristoyl ACP dehydrase;         EC=4.2.1.-;

Homologs  Archaea  0/68 : Bacteria  780/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->151 2gllF PDBj 5e-39 49.3 %
:RPS:PDB   11->151 3dozD PDBj 2e-28 48.9 %
:RPS:SCOP  11->145 1u1zA  d.38.1.6 * 6e-43 48.1 %
:HMM:SCOP  12->151 1mkaA_ d.38.1.2 * 1.1e-42 47.4 %
:RPS:PFM   19->142 PF07977 * FabA 7e-29 50.8 %
:HMM:PFM   19->143 PF07977 * FabA 2.3e-39 46.4 125/138  
:BLT:SWISS 1->151 FABZ_RHOPS 1e-87 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40075.1 GT:GENE ABE40075.1 GT:PRODUCT 3-hydroxyacyl-[acyl-carrier-protein] dehydratase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3172465..3172920) GB:FROM 3172465 GB:TO 3172920 GB:DIRECTION - GB:PRODUCT 3-hydroxyacyl-[acyl-carrier-protein] dehydratase GB:PROTEIN_ID ABE40075.1 GB:DB_XREF GI:91683773 InterPro:IPR010084 InterPro:IPR013114 LENGTH 151 SQ:AASEQ MESPIRFENVDINTILKTLPHRFPFLLIDRVRNIREDYSGIGVKNVTFNEPAFQGHFPDRPVFPGVLMIEGMAQTAGVIGIMSVSGTEKPRAVYFLTIDKCKFRKPVLPGDTVEYHMKSIGRRKTMWWFHGDAVVDGKTVAEADVGAMLTD GT:EXON 1|1-151:0| SW:ID FABZ_RHOPS SW:DE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase; EC=4.2.1.-; SW:GN Name=fabZ; OrderedLocusNames=RPD_2847; SW:KW Complete proteome; Cytoplasm; Lipid A biosynthesis; Lipid synthesis;Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|FABZ_RHOPS|1e-87|100.0|151/151| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 12->151|2gllF|5e-39|49.3|140/147| RP:PDB:NREP 1 RP:PDB:REP 11->151|3dozD|2e-28|48.9|141/149| RP:PFM:NREP 1 RP:PFM:REP 19->142|PF07977|7e-29|50.8|124/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 19->143|PF07977|2.3e-39|46.4|125/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 11->145|1u1zA|6e-43|48.1|133/142|d.38.1.6| HM:SCP:REP 12->151|1mkaA_|1.1e-42|47.4|135/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 883 OP:NHOMOORG 804 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------------------1------------1-------------111111111111111111--111121111-11111111111111111111211111111111---11111111111111111111111111111111111111111111111111222221111221112111111122111211111111112111111111111111111112-221122-2-1122112212122222221111111111111111111111111111111111111111111111111111111111111111111--1211111111111111111111211111111111111111111121111111111111-11111111111111111111111122--11111111111111111111211111111111111111111111111111111111111111111111111112111111111111111121111111111-1111111111111111111111111111111-1-121111111111111211112111121-11111111111111111111111111111111111111111111111111111111111-1111111111-11111111111111111-1111111111111111111111111111111111111111111211111111-12222221222211112222211111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111--------------1-1-------------------------1111111111121 11------1---------------------------------------------------------------------------------------------------2-------------------------------------------------------------2----1111A111113212-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 100.0 SQ:SECSTR ccccccHHcccHHHHHHHccccTTcccccEEEEEETTTEEEEEEEcccccGGGGcccTTcccccHHHHHHHHHHHHHHHHHHHHHcHHTTcEEEEEEEEEEEEcccccTTcEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEEc DISOP:02AL 1-3| PSIPRED ccccEEEccccHHHHHHHccccccEEEEEEEEEEccccEEEEEEEccccccEEccccccccEEcHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccEEccccccccEEEEEEEEEEEcccEEEEEEEEEEccEEEEEEEEEEEEEc //