[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40079.1
DDBJ      :             1-deoxy-D-xylulose 5-phosphate reductoisomerase
Swiss-Prot:DXR_RHOPS    RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase;         Short=DXP reductoisomerase;         EC=1.1.1.267;AltName: Full=1-deoxyxylulose-5-phosphate reductoisomerase;AltName: Full=2-C-methyl-D-erythritol 4-phosphate synthase;

Homologs  Archaea  0/68 : Bacteria  719/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
a.69.3c.2.1d.81.1
:407 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->402 1r0kB PDBj 3e-89 45.8 %
:RPS:PDB   17->406 2eghA PDBj 2e-38 39.3 %
:RPS:SCOP  17->162 1jvsA2  c.2.1.3 * 6e-28 35.2 %
:RPS:SCOP  140->277 1jvsA3  d.81.1.3 * 1e-57 47.8 %
:RPS:SCOP  304->406 1jvsA1  a.69.3.1 * 1e-18 34.3 %
:HMM:SCOP  15->162 1r0kA2 c.2.1.3 * 8.1e-47 48.0 %
:HMM:SCOP  139->276 1r0kA3 d.81.1.3 * 2.6e-58 56.5 %
:HMM:SCOP  303->404 1k5hA1 a.69.3.1 * 1.9e-29 50.0 %
:RPS:PFM   19->144 PF02670 * DXP_reductoisom 2e-20 53.2 %
:RPS:PFM   158->241 PF08436 * DXP_redisom_C 4e-29 64.3 %
:HMM:PFM   19->144 PF02670 * DXP_reductoisom 2.4e-41 50.0 126/129  
:HMM:PFM   158->241 PF08436 * DXP_redisom_C 1.1e-40 57.1 84/84  
:BLT:SWISS 1->407 DXR_RHOPS 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40079.1 GT:GENE ABE40079.1 GT:PRODUCT 1-deoxy-D-xylulose 5-phosphate reductoisomerase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3177927..3179150) GB:FROM 3177927 GB:TO 3179150 GB:DIRECTION - GB:PRODUCT 1-deoxy-D-xylulose 5-phosphate reductoisomerase GB:PROTEIN_ID ABE40079.1 GB:DB_XREF GI:91683777 InterPro:IPR003821 LENGTH 407 SQ:AASEQ MSAVPLKNDGAAHAGVRTISVLGATGSIGDSTMDLLRAAPEKYRVESLTGNANVAGLAKLAKEFSAKFVAVADPARLGELRAALADTEIACGAGESAVIEAASRPADWVMAAISGAAGLKPALAAVDRGATVALANKECLVCAGDFFMSRAVAAGARILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIVHGLVEFADHSVVAQLGAPDMRIPIAHCLGWPDRIAGRAARLDLAKIGQLTFEAPDFVRFPGLRLAYDALRTGNGATTVYNAANEIAVAAFIAQKIRFGAIARLVEDTLNGWVRAGNLAPLSSADDAIAVDHNARKMAATLLPQIAAKAS GT:EXON 1|1-407:0| SW:ID DXR_RHOPS SW:DE RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase; Short=DXP reductoisomerase; EC=1.1.1.267;AltName: Full=1-deoxyxylulose-5-phosphate reductoisomerase;AltName: Full=2-C-methyl-D-erythritol 4-phosphate synthase; SW:GN Name=dxr; OrderedLocusNames=RPD_2851; SW:KW Complete proteome; Isoprene biosynthesis; Metal-binding; NADP;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->407|DXR_RHOPS|0.0|100.0|407/407| GO:SWS:NREP 4 GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 338->350|naaneiavaafia| BL:PDB:NREP 1 BL:PDB:REP 17->402|1r0kB|3e-89|45.8|380/382| RP:PDB:NREP 1 RP:PDB:REP 17->406|2eghA|2e-38|39.3|382/400| RP:PFM:NREP 2 RP:PFM:REP 19->144|PF02670|2e-20|53.2|126/128|DXP_reductoisom| RP:PFM:REP 158->241|PF08436|4e-29|64.3|84/84|DXP_redisom_C| HM:PFM:NREP 2 HM:PFM:REP 19->144|PF02670|2.4e-41|50.0|126/129|DXP_reductoisom| HM:PFM:REP 158->241|PF08436|1.1e-40|57.1|84/84|DXP_redisom_C| GO:PFM:NREP 8 GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF02670|IPR013512| GO:PFM GO:0030604|"GO:1-deoxy-D-xylulose-5-phosphate reductoisomerase activity"|PF02670|IPR013512| GO:PFM GO:0046872|"GO:metal ion binding"|PF02670|IPR013512| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02670|IPR013512| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF08436|IPR013644| GO:PFM GO:0030604|"GO:1-deoxy-D-xylulose-5-phosphate reductoisomerase activity"|PF08436|IPR013644| GO:PFM GO:0046872|"GO:metal ion binding"|PF08436|IPR013644| GO:PFM GO:0055114|"GO:oxidation reduction"|PF08436|IPR013644| RP:SCP:NREP 3 RP:SCP:REP 17->162|1jvsA2|6e-28|35.2|145/152|c.2.1.3| RP:SCP:REP 140->277|1jvsA3|1e-57|47.8|138/149|d.81.1.3| RP:SCP:REP 304->406|1jvsA1|1e-18|34.3|99/99|a.69.3.1| HM:SCP:REP 15->162|1r0kA2|8.1e-47|48.0|148/151|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 139->276|1r0kA3|2.6e-58|56.5|138/0|d.81.1.3|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| HM:SCP:REP 303->404|1k5hA1|1.9e-29|50.0|98/0|a.69.3.1|1/1|1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain| OP:NHOMO 771 OP:NHOMOORG 743 OP:PATTERN -------------------------------------------------------------------- 111111111111-111111-1111111111111111111111112111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111-----111-11111111111111111111111111111111111111111111111112222221221122211111112121111-11111111111-----------------------------------------------------------------------------------------11111111111111111111111111--111111111111111111111-1111111-----1111111111111------------11111111--1-11111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111--11111--1111111111111-111111-111111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111--------11------------1------1------1111111111111 11------1---------------------------------------------------------------------------------------------------1-----------------------------------------------------------------111119111112123-1211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 392 STR:RPRED 96.3 SQ:SECSTR ##############ccEEEEEETTTcHHHHHHHHHHHHcTTTEEEEEEEEccEEcccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHTTcccEEEEcHHHHHHHHTcTTccEETTHHHHHHHHHTTcEEEEcccHHHHHHHHHHHHHHHHHTcEEEEccHHHHHHHHTccHTGGGTEEEEEEEEcccTTccccGGGGGGccHHHHTccccccccHHHHHHHHHTHHHHHHHHHHHHHHTccGGGEEEEEcTTccEEEEEEETTccEEEEEccccTHHHHHHHHHTTcccccccccccGGGccccccccccTTTcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTcccTTHHHHHHHHHHHHccGGGcccccccHHHHHHHHHHHHHHHHHHHHHHHHTc# DISOP:02AL 1-2,4-13,404-408| PSIPRED ccccccccccccccccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHccccccEEcccHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccHHHccEEEEEccccccccccHHHHHcccHHHHHcccccccccEEcccHHHHHHHHHHHHHHHHHccccHHHEEEEEccccEEEEEEEEccccEEEEcccccHHHHHHHHcccccccccccccccHHHcccccccccccccccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc //