[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40088.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->214 3frqA PDBj 5e-27 37.2 %
:RPS:PDB   38->212 3dcfA PDBj 2e-11 13.7 %
:RPS:SCOP  38->101 2i10A1  a.4.1.9 * 1e-11 28.1 %
:HMM:SCOP  29->104 2fd5A1 a.4.1.9 * 5.4e-12 25.0 %
:HMM:SCOP  104->213 2gfnA2 a.121.1.1 * 0.00052 20.0 %
:HMM:PFM   40->82 PF00440 * TetR_N 3.7e-10 34.9 43/47  
:BLT:SWISS 51->134 SLMA_HAEDU 2e-05 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40088.1 GT:GENE ABE40088.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3189846..3190499) GB:FROM 3189846 GB:TO 3190499 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID ABE40088.1 GB:DB_XREF GI:91683786 InterPro:IPR001647 LENGTH 217 SQ:AASEQ MAARCTLRPRFWPQASIAKSCGSESDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDTQEPALRALALERNELVRGAIERRLPSEPHNPEQASGLVQAVIQGACMQWLIARNGPLDAFMTEQTRQVLSVLYPGHTFE GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 51->134|SLMA_HAEDU|2e-05|32.1|84/202| SEG 140->155|epalralalernelvr| BL:PDB:NREP 1 BL:PDB:REP 33->214|3frqA|5e-27|37.2|180/185| RP:PDB:NREP 1 RP:PDB:REP 38->212|3dcfA|2e-11|13.7|175/183| HM:PFM:NREP 1 HM:PFM:REP 40->82|PF00440|3.7e-10|34.9|43/47|TetR_N| RP:SCP:NREP 1 RP:SCP:REP 38->101|2i10A1|1e-11|28.1|64/69|a.4.1.9| HM:SCP:REP 29->104|2fd5A1|5.4e-12|25.0|76/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 104->213|2gfnA2|0.00052|20.0|110/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 88.9 SQ:SECSTR ######################cTcHHccccccTTHHHHHHHHHHHHHHHTcTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHTHHHHccTTccccHHHHHHHHHHHHHHcccccHc## DISOP:02AL 1-3,14-38,215-218| PSIPRED ccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccc //