[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40097.1
DDBJ      :             methylmalonyl-CoA epimerase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  209/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:134 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->133 1jc5F PDBj 3e-18 35.9 %
:RPS:PDB   1->133 1cjxA PDBj 1e-14 14.7 %
:RPS:SCOP  4->130 1sqiA1  d.32.1.3 * 1e-18 20.8 %
:HMM:SCOP  1->133 1sp8A2 d.32.1.3 * 5.1e-33 35.3 %
:RPS:PFM   4->130 PF00903 * Glyoxalase 3e-04 30.2 %
:HMM:PFM   4->106 PF00903 * Glyoxalase 3.2e-10 19.6 102/128  
:BLT:SWISS 2->134 MCEE_HUMAN 5e-39 59.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40097.1 GT:GENE ABE40097.1 GT:PRODUCT methylmalonyl-CoA epimerase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3196789..3197193) GB:FROM 3196789 GB:TO 3197193 GB:DIRECTION - GB:PRODUCT methylmalonyl-CoA epimerase GB:PROTEIN_ID ABE40097.1 GB:DB_XREF GI:91683795 InterPro:IPR004360 LENGTH 134 SQ:AASEQ MLGRLNHVAIAVKDAEQAAKIYGAAFNAEISAAVPLPDHGVITVFVTLPNTKIEFIQPLGEASPIAKFLERNADGGIHHVCYEVPDIIAARDTLIKEGASVLGDGQPKIGAHGKPVLFLHPKDFSGALVEIEQS GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 2->134|MCEE_HUMAN|5e-39|59.1|132/176| BL:PDB:NREP 1 BL:PDB:REP 5->133|1jc5F|3e-18|35.9|128/144| RP:PDB:NREP 1 RP:PDB:REP 1->133|1cjxA|1e-14|14.7|129/352| RP:PFM:NREP 1 RP:PFM:REP 4->130|PF00903|3e-04|30.2|116/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 4->106|PF00903|3.2e-10|19.6|102/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 4->130|1sqiA1|1e-18|20.8|125/149|d.32.1.3| HM:SCP:REP 1->133|1sp8A2|5.1e-33|35.3|133/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 313 OP:NHOMOORG 295 OP:PATTERN ------1111111111-------1111-1--1----------------------1111111-----11 12211-11111-1-1------111-1------1111-111-111---1------------11111111111-----------1-----11111111---1-11111-111---------------1-11111111111111---11-------------------------------------111------11-----111-1-11111---111111111---------1--------------------------------------------------------------------------------------------11-------------------------1--1---1-1--11-112-1--1--1111-----111111111111111111111111-11111111111-111111111211111111111111111-------------111------------------------------1111-------------------------------------------------------------------------111-----------1111111-21111-111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------111-1-1----11 ----111-31----1--------------------------------------------------------------------------------------------1--1211111111111111-1-121-11211--12-23111-21111112111--1111-----1111--------1-3------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 99.3 SQ:SECSTR EEEEEEcEEccTTHHHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEcTTcccEEcTTcccHHHHHHHHHTcccccEEEEEEccHHHHHHHHHHTTccccccEEEEccHHHHHTHHHHcTTccccHHHHHH# PSIPRED cccccEEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccEEEEEEEEccccccHHHHHHccccccEEEEEEEEccHHHHHHHHHHcccEEEEccccEEcccccEEEEEEccccccEEEEEEEc //