[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40112.1
DDBJ      :             NADH dehydrogenase I, D subunit
Swiss-Prot:NUOD_RHOPS   RecName: Full=NADH-quinone oxidoreductase subunit D;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit D;AltName: Full=NDH-1 subunit D;

Homologs  Archaea  67/68 : Bacteria  603/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
e.18.1
:416 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->416 3iam4 PDBj 1e-89 43.7 %
:RPS:PDB   27->413 3curH PDBj e-102 16.8 %
:RPS:SCOP  38->416 2fug41  e.18.1.2 * e-124 45.7 %
:HMM:SCOP  38->416 2fug41 e.18.1.2 * 5.7e-139 44.3 %
:RPS:PFM   142->416 PF00346 * Complex1_49kDa 1e-90 63.0 %
:HMM:PFM   142->416 PF00346 * Complex1_49kDa 9.6e-128 63.6 272/272  
:HMM:PFM   67->134 PF00374 * NiFeSe_Hases 9.7e-05 30.9 68/507  
:BLT:SWISS 25->416 NUOD_RHOPS 0.0 100.0 %
:PROS 403->412|PS00503|PECTINESTERASE_2
:PROS 65->76|PS00535|COMPLEX1_49K
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40112.1 GT:GENE ABE40112.1 GT:PRODUCT NADH dehydrogenase I, D subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3212786..3214036) GB:FROM 3212786 GB:TO 3214036 GB:DIRECTION - GB:PRODUCT NADH dehydrogenase I, D subunit GB:PROTEIN_ID ABE40112.1 GB:DB_XREF GI:91683810 InterPro:IPR000070 InterPro:IPR001135 InterPro:IPR010219 LENGTH 416 SQ:AASEQ MAEAPMAQAPTAQAPTAEAAAEAPGLRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDYVAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRVGGVHQDLPPQLVADIDSWCDSFIQVVDDLETLLTDNRIFKQRNVDIGVVTLEQAWEWGFSGVMVRGSGAAWDLRKSQPYECYAEMDFDIPIGKNGDCYDRYCLRVEEMRQSIRIMKQCIAKLRAPDGQGRVAIDDNKIFPPRRGEMKRSMESLIHHFKLYTEGFRVPEGEVYVAVEAPKGEFGVYLVSDGSNKPYKCKIRAPGFAHLQAMDFICRGHLLADVSAILGSLDIVFGEVDR GT:EXON 1|1-416:0| SW:ID NUOD_RHOPS SW:DE RecName: Full=NADH-quinone oxidoreductase subunit D; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit D;AltName: Full=NDH-1 subunit D; SW:GN Name=nuoD; OrderedLocusNames=RPD_2884; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 25->416|NUOD_RHOPS|0.0|100.0|392/416| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 403->412|PS00503|PECTINESTERASE_2|PDOC00413| PROS 65->76|PS00535|COMPLEX1_49K|PDOC00521| SEG 1->24|maeapmaqaptaqaptaeaaaeap| BL:PDB:NREP 1 BL:PDB:REP 42->416|3iam4|1e-89|43.7|371/378| RP:PDB:NREP 1 RP:PDB:REP 27->413|3curH|e-102|16.8|374/545| RP:PFM:NREP 1 RP:PFM:REP 142->416|PF00346|1e-90|63.0|254/254|Complex1_49kDa| HM:PFM:NREP 2 HM:PFM:REP 142->416|PF00346|9.6e-128|63.6|272/272|Complex1_49kDa| HM:PFM:REP 67->134|PF00374|9.7e-05|30.9|68/507|NiFeSe_Hases| GO:PFM:NREP 4 GO:PFM GO:0016651|"GO:oxidoreductase activity, acting on NADH or NADPH"|PF00346|IPR001135| GO:PFM GO:0048038|"GO:quinone binding"|PF00346|IPR001135| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00346|IPR001135| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00346|IPR001135| RP:SCP:NREP 1 RP:SCP:REP 38->416|2fug41|e-124|45.7|370/370|e.18.1.2| HM:SCP:REP 38->416|2fug41|5.7e-139|44.3|375/0|e.18.1.2|1/1|HydB/Nqo4-like| OP:NHOMO 1177 OP:NHOMOORG 821 OP:PATTERN 11313121111111113112222121121311212222222222122411223132242531111-11 22213---------11122-21--21212221111111112111-1--1-----------22122112221--------21112322311111---1--1-11--22211--------------1111111111213332333321111111111111111111112111111111111111111111--1-1-111111111111111------111111----------1-------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111312112112533311111111111-11111111111111112222212222111111222211111111111322-12231111111111111111111111111111111111-111111111111111111121111111111121111111111111231111111111111111111121111-1-2---342223-433243417332313-2122211111111111111111231322221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222233332231-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------12111111111111112-112211------------------------------------121111-11-241 ------1-----11111111111111111111111111111111111111111111111111111----1--111------11111---12111241111111112-11-222112-1111111221212B1-1121111111111111-111111-111211116222121232111--------1131-3------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 93.8 SQ:SECSTR ##########################ccEEEEEccccccHcccEEEEEEEETTEEEEEEEETEcccccHHHHHTTccGGGHHHHHHTTccTTTTHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGTccTGGGGGcHHHHHHHHHHHHTcccGGGTTcTTTTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEETTEEccGGGGcHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTGGGGGccccccEEEccEEEcccccHHHHHHHEEEccccEEEcTcTTcTTcccccHccGGGEEEEcTTccccTTcTTccGGcccGGcccccccccTTcTTccccccEEEETTccccccHHHHHHHHHcHHHHHHHHHHHHHTTccGGGcHH DISOP:02AL 1-23| PSIPRED ccccccccccccccccHHHHHccccccEEEEEcccccccccccEEEEEEEEccEEEEEEEEcccccccHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccEEccHHHHHHcccccEEHHHcccccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccccEEEEEEEEcccccEEEEEEEccccccHHHHHHHHHcccccHHHHHHHHcccccccccc //