[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40116.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->60 PF01644 * Chitin_synth_1 0.00034 22.4 49/163  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40116.1 GT:GENE ABE40116.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3216032..3216226 GB:FROM 3216032 GB:TO 3216226 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40116.1 GB:DB_XREF GI:91683814 LENGTH 64 SQ:AASEQ MNHSIHSADRATHLKIVVVALVAGIGVAAFGISARVSADYSQTAHVVKATKQITVTSSESSIVR GT:EXON 1|1-64:0| TM:NTM 1 TM:REGION 14->36| SEG 16->34|ivvvalvagigvaafgisa| HM:PFM:NREP 1 HM:PFM:REP 12->60|PF01644|0.00034|22.4|49/163|Chitin_synth_1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,64-65| PSIPRED ccccEEcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEEEEcccEEEEEEcccEEcc //