[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40142.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.127.1
:316 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  43->142 1c21A  d.127.1.1 * 8e-04 25.3 %
:BLT:SWISS 166->303 NDVA_BRAJA 9e-04 23.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40142.1 GT:GENE ABE40142.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3250131..3251081 GB:FROM 3250131 GB:TO 3251081 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE40142.1 GB:DB_XREF GI:91683840 LENGTH 316 SQ:AASEQ MGPTVAKRQTNRQITASFHYLVKTEKSDDKNKEPTEAGFTLGEFEKLRARIANTTLLDVNDERVVTRIKLGEDLPFTHYELVENQLHFGEFEGAYYGQEYRNNKLGTISADSLNLRKFHYLLTRLRDGRILIGVTYNGQFGDYEGVRQCFSHLLKSNATVTSRTIKSISDEIGKGEPVEVKLTFRTARERPERKGLFGRSGVIAIKSTEYGDGFGEEVAKMAKRAKGTLFDRKRSIAALVKSSAMIELDDDDIIAVTALVREEGRTRTVYFLGENSFSTKYPLNVTVSTNGKANRSEVRSELIKLMRTKIIPLIDG GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 166->303|NDVA_BRAJA|9e-04|23.9|134/100| RP:SCP:NREP 1 RP:SCP:REP 43->142|1c21A|8e-04|25.3|91/263|d.127.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,24-37,294-294| PSIPRED ccccccccccccEEEEEEEEEEEcccccccccccHHccccHHHHHHHHHHHcccEEEEEcccEEEEEEEcccccccHHHHHHHcccccccccccccccHHcccccEEEEcccccHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEEEEHHcccHHHccccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEccccEEEEEEEHHccccEEEEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccc //