[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40146.1
DDBJ      :             adenosylcobyric acid synthase (glutamine-hydrolysing)
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  431/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.37.1e.50.1
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   327->398 1ka9H PDBj 5e-04 35.4 %
:RPS:PDB   121->389 1c30B PDBj 2e-20 14.7 %
:RPS:SCOP  30->210 1xfiA  e.50.1.1 * 5e-19 17.0 %
:RPS:SCOP  227->435 1fy2A  c.23.16.4 * 3e-13 13.1 %
:HMM:SCOP  27->281 1byiA_ c.37.1.10 * 1.3e-47 38.6 %
:HMM:SCOP  289->490 1ka9H_ c.23.16.1 * 8e-33 29.2 %
:RPS:PFM   327->477 PF07685 * GATase_3 8e-16 41.8 %
:HMM:PFM   324->478 PF07685 * GATase_3 3.9e-42 45.3 150/158  
:HMM:PFM   29->269 PF01656 * CbiA 9.6e-27 25.3 170/194  
:BLT:SWISS 26->514 COBQ_RHILO e-139 53.4 %
:PROS 354->362|PS00482|DIHYDROOROTASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40146.1 GT:GENE ABE40146.1 GT:PRODUCT adenosylcobyric acid synthase (glutamine-hydrolysing) GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3253318..3254895) GB:FROM 3253318 GB:TO 3254895 GB:DIRECTION - GB:PRODUCT adenosylcobyric acid synthase (glutamine-hydrolysing) GB:PROTEIN_ID ABE40146.1 GB:DB_XREF GI:91683844 InterPro:IPR002195 InterPro:IPR002586 InterPro:IPR004459 InterPro:IPR011698 LENGTH 525 SQ:AASEQ MTTVDVDELVSRIQFSPRPHSGPRRARALMIQGTSSDVGKSMVVAGLCRAFARRGLVVRPFKAQNMSNNAAVASDSDLPPGADGTRIRGEIGRAQALQARACGVAPSIHMNPVLLKPQTDIGAQVVLRGRVLGNCPARIYHHMRQRLIPAVLDSFERLAAEADLVLVEGAGSGAEVYLRASDITNMRFAEAADLPVVFLSDIDRGGTMAALVGSYVLLNEGDRARVVGYLINKFRGDFSLFEPGCRTITEQTGWPFLGVLRWFPGADRLPAEDSLALERAAAASRGRLKIAVPRLQRVANFDDLDPLVAEPDVDLRWIQPGSPIPGDVDVVVLPGSKATRIELDLIRREGWDVDIHAHVRRGGRVVGLCAGFQMLGRVVRDPMGIEGAPGETAGLGLLDIETEISGDKRLVEIDARDRLSGRRVAGYEMHMGRTIGAGLDRPWLLLEEGAGEPRPEGAVSADGRVMGGYLHGLFGGDDFRSAWLTQIGAATSGLDFEHRVEQTLEALADHCESNLDLDALLALAR GT:EXON 1|1-525:0| BL:SWS:NREP 1 BL:SWS:REP 26->514|COBQ_RHILO|e-139|53.4|479/491| PROS 354->362|PS00482|DIHYDROOROTASE_1|PDOC00401| SEG 271->285|aedslaleraaaasr| SEG 444->458|llleegageprpega| SEG 515->524|ldldallala| BL:PDB:NREP 1 BL:PDB:REP 327->398|1ka9H|5e-04|35.4|65/195| RP:PDB:NREP 1 RP:PDB:REP 121->389|1c30B|2e-20|14.7|251/379| RP:PFM:NREP 1 RP:PFM:REP 327->477|PF07685|8e-16|41.8|141/151|GATase_3| HM:PFM:NREP 2 HM:PFM:REP 324->478|PF07685|3.9e-42|45.3|150/158|GATase_3| HM:PFM:REP 29->269|PF01656|9.6e-27|25.3|170/194|CbiA| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 2 RP:SCP:REP 30->210|1xfiA|5e-19|17.0|153/343|e.50.1.1| RP:SCP:REP 227->435|1fy2A|3e-13|13.1|183/220|c.23.16.4| HM:SCP:REP 27->281|1byiA_|1.3e-47|38.6|223/224|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 289->490|1ka9H_|8e-33|29.2|195/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 508 OP:NHOMOORG 485 OP:PATTERN ------1111111111-1-----1111111111111111111111111111111-1-111-111--11 ---11-11----1-11111-11--1111111111111111-111----------------11211111111----------11-----11-1-1-1---------1-1-----------------11111111111111111111-111111111111111111111111111111111111111111----1-----------------1-------1111---11111111---------------------------------11---------------------------------------------1----------111111111111111111111111---1111111111--111111--2111-122------11111---2222211111111111121111111-1--1111111111111111-111123311111111111-11-1113-------------------------------111------1111111111111111111111111111--1111211111111111111111-----------111-1111-11111111-111211111-----1-1-----------------------------2-111-11-11111-1111111111121----11-------1---2--------------------------------111--11-1111111111111111----------1------------------------111-1---------------------1---1111111111111111111----------11111111111111--11111---------1---1111--------1---------------------------1--11------11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 493 STR:RPRED 93.9 SQ:SECSTR #####HHHHHHHHHHHHHHccTTcccEEEEEEEccTTccHHHHHHHHHHHHHHTTccEEEEccETTccTTTTTcccccEEcccccccccccHHHHHHHHHccccccHHHHccEEEcccccccccEEEEEEEEEEcccccHHHHTEEEEcccGGGcccccccccEEEEccccccccccTTccccHHHHHHHTTTcccEEEEcccHHHHHHHHHHHHHHHHTTHHccEEEEEEEcccccHHHHHHHHHHccccTTccHHHHcccccEEEccccccTTTcccccccGGGcEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEccccccccccccTTcHHHHHHHHHHHTccccEEEETHHHHHHHHHTTccEEEEEEEcccccEEEEEEcccccTTcTTccTTcEcTTcEEEEccccccEEEcccccEEEEEEcccccccGGGEEEEEcccccEEEEccccTTTTcTTTTccTHHHHHHHHHTcccc########################### DISOP:02AL 1-2,13-26| PSIPRED ccEEEHHHccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEcccccccccEEccccccccccccccccccccHHHHHHHHHcccccccccccEEEcccccccEEEEEEEEEcccccHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccHHHcccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHccccccEEEEEEEccccccccHHHHHHHccccEEEEEcccccccccccEEEEcccccHHHHHHHHHHcccHHHHHHHHHccccEEEEEHHHHHHHHHcccccccccccccccccEEEccEEEEccccEEEEEEEEEcccccEEEEEEEEEEEEEcccccccEEEEEcccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHcc //