[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40151.1
DDBJ      :             transport system permease protein
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  506/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.22.1
:336 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->326 2nq2B PDBj 4e-12 28.0 %
:RPS:SCOP  46->326 1l7vA  f.22.1.1 * 4e-31 23.3 %
:HMM:SCOP  7->327 1l7vA_ f.22.1.1 * 3.1e-66 45.2 %
:RPS:PFM   17->326 PF01032 * FecCD 3e-23 31.6 %
:HMM:PFM   17->326 PF01032 * FecCD 2.1e-85 46.8 308/311  
:BLT:SWISS 49->328 YFMD_BACSU 9e-20 26.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40151.1 GT:GENE ABE40151.1 GT:PRODUCT transport system permease protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3258832..3259842) GB:FROM 3258832 GB:TO 3259842 GB:DIRECTION - GB:PRODUCT transport system permease protein GB:PROTEIN_ID ABE40151.1 GB:DB_XREF GI:91683849 InterPro:IPR000522 LENGTH 336 SQ:AASEQ MRVAEGAAAPLILASGVIVLFLLSLSIGPVRLPIGAVVDALLGGGTDAERSIVREIRLPRAILAVAIGAMHGLAGAALQGLLRNPLASPSLFGAPQAAAFGAVLVISAGLADALSFLLPLAAIAMAFVSVFILIAVAGRNANLLLLILAGLALSSLAGAATSLALNLAANPFAALEISFWLLGSLEDRSFQHVTLALPFIVCGAALLFTRGEAFRVLSLGEEAAQSLGVDVGRLRLQVIMGVALGVGASVAVSGTIGFIGLVVPHLMRPFVGHDPGRLLLPSALGGAALLLAADISVRLIPSSSGIKVGVVTALIGVPFFLYLVVRERRTLSSSMT GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 49->328|YFMD_BACSU|9e-20|26.4|276/333| TM:NTM 10 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 56->78| TM:REGION 97->119| TM:REGION 129->151| TM:REGION 162->184| TM:REGION 189->211| TM:REGION 240->262| TM:REGION 278->300| TM:REGION 305->326| SEG 68->82|gamhglagaalqgll| SEG 137->175|agrnanllllilaglalsslagaatslalnlaanpfaal| SEG 241->254|gvalgvgasvavsg| SEG 278->293|lllpsalggaalllaa| BL:PDB:NREP 1 BL:PDB:REP 32->326|2nq2B|4e-12|28.0|286/300| RP:PFM:NREP 1 RP:PFM:REP 17->326|PF01032|3e-23|31.6|310/313|FecCD| HM:PFM:NREP 1 HM:PFM:REP 17->326|PF01032|2.1e-85|46.8|308/311|FecCD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01032|IPR000522| GO:PFM GO:0006810|"GO:transport"|PF01032|IPR000522| GO:PFM GO:0016020|"GO:membrane"|PF01032|IPR000522| RP:SCP:NREP 1 RP:SCP:REP 46->326|1l7vA|4e-31|23.3|279/324|f.22.1.1| HM:SCP:REP 7->327|1l7vA_|3.1e-66|45.2|312/324|f.22.1.1|1/1|ABC transporter involved in vitamin B12 uptake, BtuC| OP:NHOMO 1272 OP:NHOMOORG 543 OP:PATTERN ---------------------112122212111--11-112111154634981-2121221--1---- -----2126674431------1---3----------1824-11--1---11-31---1--22-54212373--------1211-----11---------------1122----------------121-211-212123111125-5-2211-11--------12-123--------------1-2--22-1347787867738788874666888883746322111112CA-111-1111111111211112----------11-1--1---------------1--11111111111-------------111---111-2381377766873831211165524---31--2762--3111-2112-4-21-211111111111--2333432422222222224-32-22232221-433544334444--12-21511111--22222222-331--31------------------------------1111211111122223-2222--1-222211211-112--111-----1----1111-1-12-------------1-5322-122-3111--------23-----123-231-11112----------11---1112112111211-22211121--1-12-212---1-2-------7253142-222-223---1---222-2-122------445331432-222222222222223--2111-2-244444434444--1-----------1228111131-----1--4--11-1--112111112324-2221-333---------13111121124252211---------------111------------3---------------------------1121-2-222-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 87.8 SQ:SECSTR ###############################HHHHHHHHHTccTccccccccGGGTcHHHHHHHHHHHHHHHHHHHHHHHHTTcTTccTTcccHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHTccTTTHHHTTHHHHHHHHHccccTTccHHHHHHHHHHHHHHHHHHHHTTTGGGGGGccHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHccccccTTTHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHTc########## DISOP:02AL 1-1,331-337| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEcccc //