[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40155.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   66->99 PF11319 * DUF3121 0.00013 30.3 33/183  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40155.1 GT:GENE ABE40155.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3263722..3264132) GB:FROM 3263722 GB:TO 3264132 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40155.1 GB:DB_XREF GI:91683853 LENGTH 136 SQ:AASEQ MRTMVVMVALLASTAALAQSQSAPSSPPPMVGDRPLVQVKPRGEKIATTDADAKPAKPGKQSIAVQLQACLEIEDGSKGRLDCYDAIFPPKPKALKPGAKQKAAKAVADCRFTKEEDERLACFNGFAESVPKLPKS GT:EXON 1|1-136:0| SEG 9->29|allastaalaqsqsapssppp| SEG 89->108|ppkpkalkpgakqkaakava| HM:PFM:NREP 1 HM:PFM:REP 66->99|PF11319|0.00013|30.3|33/183|DUF3121| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,17-30,96-101,134-137| PSIPRED ccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHccHHHcccccccc //