[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40164.1
DDBJ      :             Phenylacetic acid degradation-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->132 1vi8G PDBj 1e-11 34.5 %
:RPS:PDB   13->132 3dkzA PDBj 3e-16 20.4 %
:RPS:SCOP  13->132 1zkiA1  d.38.1.5 * 7e-20 25.6 %
:HMM:SCOP  4->132 1zkiA1 d.38.1.5 * 4e-31 34.9 %
:HMM:PFM   46->123 PF03061 * 4HBT 1e-16 26.0 77/79  
:HMM:PFM   15->75 PF07128 * DUF1380 5.2e-05 31.1 61/139  
:BLT:SWISS 12->123 Y1847_MYCTU 3e-13 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40164.1 GT:GENE ABE40164.1 GT:PRODUCT Phenylacetic acid degradation-related protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3271538..3271936) GB:FROM 3271538 GB:TO 3271936 GB:DIRECTION - GB:PRODUCT Phenylacetic acid degradation-related protein GB:PROTEIN_ID ABE40164.1 GB:DB_XREF GI:91683862 InterPro:IPR003736 InterPro:IPR006683 LENGTH 132 SQ:AASEQ MTLLELINSQPLPFAASMGISFAEATPDRVVATMLVRPDLCTLGHAIHGGAVMALADTVGAAATFVNLPADAKGTTTLESKTNFVAAAKAGTTVRAIATPVHRGKRTQVWQTRIETEEGRLVALVTQTQMVL GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 12->123|Y1847_MYCTU|3e-13|33.3|111/140| BL:PDB:NREP 1 BL:PDB:REP 18->132|1vi8G|1e-11|34.5|113/137| RP:PDB:NREP 1 RP:PDB:REP 13->132|3dkzA|3e-16|20.4|113/121| HM:PFM:NREP 2 HM:PFM:REP 46->123|PF03061|1e-16|26.0|77/79|4HBT| HM:PFM:REP 15->75|PF07128|5.2e-05|31.1|61/139|DUF1380| RP:SCP:NREP 1 RP:SCP:REP 13->132|1zkiA1|7e-20|25.6|117/126|d.38.1.5| HM:SCP:REP 4->132|1zkiA1|4e-31|34.9|126/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 183 OP:NHOMOORG 172 OP:PATTERN -------------------------------------------------------------------- -----1-1111---2--11-1-----11111-----2223---1---1------------11------1-------------1-----111--1--1----111---11----------------1111111111----11---1--------------------------------------21111---1-1111111111111111--11--1111-1----------------------------------------------------------------------------------------------------------------------------------1---------------------1--1--2-------111---11111--------------1-------1---------------12---1--------------------1--------------------------------11-1-------------------111111-1--1---1----------1-------2-------------11-1-2--1--------------------1------------------------------------1--------1-----1111------1-11--------------------1111111111-1111111111111111111-------------------------1111111-----------------------------------------------------------------1-----------------------111111-----11----------------------------------------------------------------------- ----11-------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHTTTcHHHHHTcEEEEEETTEEEEEEccccTTccccccccHHHHHHHHHHHHHTTTHTTccTccTTccEEEEEEEEEccccccEEEEEEEEEEEEcccEEEEEEEEEETTccEEEEEEEEEEEc DISOP:02AL 7-7| PSIPRED ccHHHHHHHccccHHHHccEEEEEEEccEEEEEEEccHHHcccccEEHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEccccccEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEEEEEEc //