[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40186.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->128 PF03741 * TerC 1.5e-22 24.4 127/184  
:BLT:SWISS 3->132 YJBE_BACSU 7e-16 34.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40186.1 GT:GENE ABE40186.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3297342..3297752) GB:FROM 3297342 GB:TO 3297752 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40186.1 GB:DB_XREF GI:91683884 LENGTH 136 SQ:AASEQ MHLRIIFTGIVVSLMEWPYLKLVGRLALLVIAAKLLVPENDDEDSVESGAHLWHAVQIVVVADIIMSLDNVIAAAANGSVPLLILGLAISVPMIVAGAALIMLVLEKLTPLVWAGAALIGWIAGEVIARSTRRFVR GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 3->132|YJBE_BACSU|7e-16|34.1|129/218| TM:NTM 4 TM:REGION 19->41| TM:REGION 53->75| TM:REGION 81->103| TM:REGION 108->130| SEG 26->37|lallviaakllv| SEG 113->124|wagaaligwiag| HM:PFM:NREP 1 HM:PFM:REP 2->128|PF03741|1.5e-22|24.4|127/184|TerC| OP:NHOMO 111 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------1-------1--11---223----------12---------------------------------------------------------------------------------------------1---------------------------3-22-----------------------------111111111--------------------------------------22----------------------------------------------------------------233241111111111111-111111111-221--1---1111122-13-331--------------1-1-1-------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 38-51,136-137| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //