[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40190.1
DDBJ      :             DNA polymerase III, chi subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.128.1
:150 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->137 1em8A  c.128.1.1 * 6e-20 19.9 %
:HMM:SCOP  1->141 1em8A_ c.128.1.1 * 1.5e-39 42.4 %
:RPS:PFM   1->137 PF04364 * DNA_pol3_chi 2e-16 34.6 %
:HMM:PFM   1->137 PF04364 * DNA_pol3_chi 5.8e-45 46.7 135/137  
:BLT:SWISS 1->91 Y872_RICPR 1e-08 29.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40190.1 GT:GENE ABE40190.1 GT:PRODUCT DNA polymerase III, chi subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3301206..3301658) GB:FROM 3301206 GB:TO 3301658 GB:DIRECTION - GB:PRODUCT DNA polymerase III, chi subunit GB:PROTEIN_ID ABE40190.1 GB:DB_XREF GI:91683888 InterPro:IPR002110 InterPro:IPR007459 LENGTH 150 SQ:AASEQ MTDVLFYHLQGRTIEQVLPPLLEKSLARGWRVVVQSGSEERTETLDAHLWTYRDDSFLPHATSRVADAAHQPIVLTAEEGNPNAAMVRFLLDNVALPADAESYERMVLLFDGDDDDAVAMARVAWKQSKSRGFDVTYWQADAAGRWQRRE GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->91|Y872_RICPR|1e-08|29.7|91/165| SEG 111->116|dgdddd| RP:PFM:NREP 1 RP:PFM:REP 1->137|PF04364|2e-16|34.6|136/137|DNA_pol3_chi| HM:PFM:NREP 1 HM:PFM:REP 1->137|PF04364|5.8e-45|46.7|135/137|DNA_pol3_chi| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04364|IPR007459| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF04364|IPR007459| GO:PFM GO:0006260|"GO:DNA replication"|PF04364|IPR007459| RP:SCP:NREP 1 RP:SCP:REP 1->137|1em8A|6e-20|19.9|136/147|c.128.1.1| HM:SCP:REP 1->141|1em8A_|1.5e-39|42.4|139/147|c.128.1.1|1/1|DNA polymerase III chi subunit| OP:NHOMO 91 OP:NHOMOORG 91 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111111111111111111111111111111111111111-1111111-------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 142-151| PSIPRED ccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccHHcccccccccccccccccEEEEcccccccccEEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccEEcc //