[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40195.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.223.1d.26.1
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->308 2pv3A PDBj 6e-07 18.3 %
:RPS:PDB   232->295 2bjrB PDBj 8e-04 12.5 %
:RPS:SCOP  32->199 1m5yA1  a.223.1.2 * 5e-12 15.5 %
:RPS:SCOP  171->269 1m5yA2  d.26.1.1 * 7e-10 13.1 %
:HMM:SCOP  29->201 1m5yA1 a.223.1.2 * 4.8e-30 26.1 %
:HMM:SCOP  170->272 1m5yA2 d.26.1.1 * 3.5e-06 21.6 %
:RPS:PFM   31->137 PF09312 * SurA_N 8e-07 29.9 %
:HMM:PFM   53->134 PF09312 * SurA_N 5.7e-13 23.2 82/118  
:BLT:SWISS 45->301 SURA_SACD2 3e-10 20.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40195.1 GT:GENE ABE40195.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3308439..3309368 GB:FROM 3308439 GB:TO 3309368 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40195.1 GB:DB_XREF GI:91683893 LENGTH 309 SQ:AASEQ MTTKFLFRILGLALFCTVTVGGGLGVATAQSVAVMVNGEPITNFDIEQRSKLDRLSRASRTRQQVLDELIDEKVKIREGKKYGVSPSDSDIESSFSTMSSRMRMSPDQMTKMLSAQGIRPETLKSKIKAEMVWASLVRGRFKDSLLVGEKDIQAQLGAKGGDEPATTESFEYQLRPVVLIVSRGSDSSALEARRKEAESLRSRVQSCADADRIFKALPNTAIRSTVVKTSADLPQALREILDKTPVGQMTAPEATKQGIEMVALCSRKPTTADTPKKREIREKLFAEKFQAKSKEYLREVRNAAMIEVR GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 45->301|SURA_SACD2|3e-10|20.9|254/430| SEG 17->29|tvtvggglgvata| SEG 85->105|spsdsdiessfstmssrmrms| BL:PDB:NREP 1 BL:PDB:REP 32->308|2pv3A|6e-07|18.3|268/284| RP:PDB:NREP 1 RP:PDB:REP 232->295|2bjrB|8e-04|12.5|64/350| RP:PFM:NREP 1 RP:PFM:REP 31->137|PF09312|8e-07|29.9|107/117|SurA_N| HM:PFM:NREP 1 HM:PFM:REP 53->134|PF09312|5.7e-13|23.2|82/118|SurA_N| RP:SCP:NREP 2 RP:SCP:REP 32->199|1m5yA1|5e-12|15.5|161/173|a.223.1.2| RP:SCP:REP 171->269|1m5yA2|7e-10|13.1|99/107|d.26.1.1| HM:SCP:REP 29->201|1m5yA1|4.8e-30|26.1|165/0|a.223.1.2|1/1|Triger factor/SurA peptide-binding domain-like| HM:SCP:REP 170->272|1m5yA2|3.5e-06|21.6|102/107|d.26.1.1|1/1|FKBP-like| OP:NHOMO 59 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111---------11-11111111111111111--1-----1--------------11-----------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 89.6 SQ:SECSTR ###############################EEEEETTEEEEHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHTTccHHHHHHHHTTTTcccTTTHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHTcccccHcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccHHHHHHTTcccTTTTTTcEEEEETHHTcccEEcccccTTcccEEEEEEETTEEEEEEEETTTTEETTEEEEEEGGGGGGcEEEEEEcTHHHHHHHTccEEE# DISOP:02AL 1-1,52-63,215-226,287-287,290-290| PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccHHHccHHHHHHHHHcccccEEccEEcccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //