[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40200.1
DDBJ      :             guanylate kinase
Swiss-Prot:KGUA_RHOPS   RecName: Full=Guanylate kinase;         EC=2.7.4.8;AltName: Full=GMP kinase;

Homologs  Archaea  0/68 : Bacteria  889/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->203 2ancD PDBj 3e-48 49.7 %
:RPS:PDB   13->35 3czpB PDBj 3e-04 26.1 %
:RPS:PDB   26->141 2ao9E PDBj 1e-20 8.0 %
:RPS:PDB   145->193 3cm0A PDBj 8e-04 16.3 %
:RPS:SCOP  13->203 1jxmA2  c.37.1.1 * 4e-36 26.1 %
:HMM:SCOP  10->199 1kjwA2 c.37.1.1 * 1e-70 49.2 %
:RPS:PFM   17->193 PF00625 * Guanylate_kin 9e-46 48.9 %
:HMM:PFM   17->195 PF00625 * Guanylate_kin 1.5e-53 41.0 178/183  
:BLT:SWISS 1->219 KGUA_RHOPS e-125 100.0 %
:PROS 49->66|PS00856|GUANYLATE_KINASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40200.1 GT:GENE ABE40200.1 GT:PRODUCT guanylate kinase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3313669..3314328) GB:FROM 3313669 GB:TO 3314328 GB:DIRECTION - GB:PRODUCT guanylate kinase GB:PROTEIN_ID ABE40200.1 GB:DB_XREF GI:91683898 InterPro:IPR008144 InterPro:IPR008145 LENGTH 219 SQ:AASEQ MKDGSGGFNGVERRGLMFVLSSPSGAGKTTLSRMLVDEAPGLTMSVSATTRPRRPGEVDGRDYYFVDRPKFDAMVEADEFLEWAHVFDNCYGTPRAPVEAALAAGRDVLFDIDWQGTQQLRSRASNDVVSVFILPPSVQDLEHRLHTRAQDSDEVIRGRMKKAGDEMSHFDAYDYIVVNDNIGVAFESVKAILRAEQLKRERQIGIEAFVRDMRRQLEK GT:EXON 1|1-219:0| SW:ID KGUA_RHOPS SW:DE RecName: Full=Guanylate kinase; EC=2.7.4.8;AltName: Full=GMP kinase; SW:GN Name=gmk; OrderedLocusNames=RPD_2974; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|KGUA_RHOPS|e-125|100.0|219/219| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 49->66|PS00856|GUANYLATE_KINASE_1|PDOC00670| BL:PDB:NREP 1 BL:PDB:REP 14->203|2ancD|3e-48|49.7|189/204| RP:PDB:NREP 3 RP:PDB:REP 13->35|3czpB|3e-04|26.1|23/452| RP:PDB:REP 26->141|2ao9E|1e-20|8.0|112/115| RP:PDB:REP 145->193|3cm0A|8e-04|16.3|49/184| RP:PFM:NREP 1 RP:PFM:REP 17->193|PF00625|9e-46|48.9|176/183|Guanylate_kin| HM:PFM:NREP 1 HM:PFM:REP 17->195|PF00625|1.5e-53|41.0|178/183|Guanylate_kin| RP:SCP:NREP 1 RP:SCP:REP 13->203|1jxmA2|4e-36|26.1|184/199|c.37.1.1| HM:SCP:REP 10->199|1kjwA2|1e-70|49.2|187/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1872 OP:NHOMOORG 1080 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111--111111111111111111111-111111111111---111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111121-211222221111112111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111111111311111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------111111-11111111111111111111111111111-11 11-1112-5211222-1111111-11-11111121211-1-11111112232322322322211111111111111111111111111-1111111111111111112719NLDKM97334595TL2S2**C1V8T4554D59F855326C23L6989B26635563N55C86543454Q1111252241322311111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 97.7 SQ:SECSTR #####HHcHccccEEEEEEEEGGGTHHHHHHHTTccHHHHHHHHHHHHHHccccccHHHHHHHHTccHHHHHHHHHcHHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHccccccHHHHHTHHHHHTTccccccccccccccEEEEcEccHHHHHHHHTTTcccccTTccTTTcccEEccGGGcHHHHHHHHHHHHHHHHHHHHHGGcEEEEETTccG DISOP:02AL 1-2,4-4,54-56,146-155,217-220| PSIPRED ccccccccccccccccEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccccccccccEEEccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEcccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcc //