[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40205.1
DDBJ      :             3-oxoacyl-[acyl-carrier-protein] reductase
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  877/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:245 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->245 3ennB PDBj 1e-56 49.4 %
:RPS:PDB   32->244 2d1yB PDBj 2e-33 26.8 %
:RPS:SCOP  32->245 1pwxA  c.2.1.2 * 4e-41 22.3 %
:HMM:SCOP  1->241 1zemA1 c.2.1.2 * 4.6e-91 48.3 %
:RPS:PFM   33->169 PF00106 * adh_short 6e-17 38.7 %
:HMM:PFM   8->170 PF00106 * adh_short 3.6e-42 33.3 159/167  
:HMM:PFM   170->217 PF07322 * Seadorna_Vp10 0.00015 34.0 47/241  
:BLT:SWISS 1->245 NODG_RHIS3 2e-65 51.8 %
:PROS 139->167|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40205.1 GT:GENE ABE40205.1 GT:PRODUCT 3-oxoacyl-[acyl-carrier-protein] reductase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3318794..3319531) GB:FROM 3318794 GB:TO 3319531 GB:DIRECTION - GB:PRODUCT 3-oxoacyl-[acyl-carrier-protein] reductase GB:PROTEIN_ID ABE40205.1 GB:DB_XREF GI:91683903 InterPro:IPR001509 InterPro:IPR002198 InterPro:IPR002347 InterPro:IPR002424 InterPro:IPR011284 LENGTH 245 SQ:AASEQ MFDLTGRTALVTGATGGIGGAIAQALHGQGATVAISGTRREALDTLAAKLGDRVHVLPCNLSDASEVEALVPAAAEAMGQLDILVCNAGITRDNLFVQLRDEDWDEVIKVNLTATFRLTRAATKLMMRKKFGRIIAITSVVGVTGNPGQGNYTASKAGLIGMIKTLGAEYAKRNVTANCIAPGFIATPMTDVLNDKQREAILGKVPAGRLGTPEDIAAAAVYLSSNEAAYVTGQTIHVNGGMAMI GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 1->245|NODG_RHIS3|2e-65|51.8|245/245| PROS 139->167|PS00061|ADH_SHORT|PDOC00060| SEG 9->31|alvtgatggiggaiaqalhgqga| SEG 64->77|asevealvpaaaea| SEG 112->123|ltatfrltraat| BL:PDB:NREP 1 BL:PDB:REP 1->245|3ennB|1e-56|49.4|239/242| RP:PDB:NREP 1 RP:PDB:REP 32->244|2d1yB|2e-33|26.8|209/242| RP:PFM:NREP 1 RP:PFM:REP 33->169|PF00106|6e-17|38.7|137/169|adh_short| HM:PFM:NREP 2 HM:PFM:REP 8->170|PF00106|3.6e-42|33.3|159/167|adh_short| HM:PFM:REP 170->217|PF07322|0.00015|34.0|47/241|Seadorna_Vp10| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 32->245|1pwxA|4e-41|22.3|211/252|c.2.1.2| HM:SCP:REP 1->241|1zemA1|4.6e-91|48.3|240/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 13719 OP:NHOMOORG 1123 OP:PATTERN 222124388686766318-321116337235822---------21143--311-23112232844123 FDO5c3-533A252V*lKK-Kr22Z*KJKKKQz***Yw**5pB*KKB53C82MEK85A11JHV4KGVUWTF11111121196S11222665527221--53M39Cd8S6D11111111111111254547422665DCCFI222FD67C93253222211522142CC7M3111121121111E9789551F6NFFGFGIFIEFGGHIFNELLHMGFG8GHNIEB888887HX7666665466666659BBAC62A28925121574489567887444545354533333333333333455554555555522211122264357B5554444446856625756331178222B7123324333345522C2EhKKS11111J8*gh779XQWVNGIKIFHJHKKR-GKUHGlGQVsY1wddMaXi*yspnVbGMCLKUQGORFFK88888888QSOB6C9B11111111111222331221222121111CEt*M7JlcTcwkqtsrORQROhhurSRSRCQ*W*X*se47PRJJAHHGWIZKiq9C84749B51221111135LB85N68312111422314643D538488AAJM331222122112113111111121221669A88BCE6LD4676588CB7667B69786A1-23338111111CEEB5H6DDDCDBBBDD-DDEDCABCCDDBECCDDCBJPLC868AB89AAABABBA9A9A9S9AA887B31999999999999111434233BBAB3BGKF111626111111352FGILG6C589J8SQPQIMNaFJJOKHMKL5242243223445D5455489689HGJGKFECDF65551243887666--------1-2--------1-1------1-------3242165676394 11--87D-412-5BAhobYfajVuosfLNHKJLJKIGPKNENNHKHSRTZfp**TYSJJNKJA8G2674A22D8A222226A9AEA-8-KgJoGYDBBA8FBBGDC-AO9*EKBDBB82533A4CB193HyD-99E6456C56C746345A34B777BOMOI8TIEC98A89EHE5884h2327ICWRxbZCBASEFD9 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 100.0 SQ:SECSTR GGGGTTcEEEEEcTTcHHHHHHHHHHHTTTcEEEEEEccTTHHHHHHHHHHHTcEEEEccTTcHHHHHHHHHHHHHHHccccEEEEcccccccccTTTccHHHHHHHHHHHTHHHHHHHHHHHHHHGGGTcEEEEEEccGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEcccccHHHHcHHccHHHHHHTTcTTcccccHHHHHHHHHHHHcGGGTTccccEEEEcTTGGGc PSIPRED cccccccEEEEEcccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEcccccccccHHHccHHHHHHHHHHccccEEEEHHcccHHHHHccccEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccccc //