[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40213.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:315 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->294 PF09991 * DUF2232 0.0004 21.4 276/290  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40213.1 GT:GENE ABE40213.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3327142..3328089 GB:FROM 3327142 GB:TO 3328089 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE40213.1 GB:DB_XREF GI:91683911 LENGTH 315 SQ:AASEQ MMIQILIAIAAGCASALMFASIISGALISLLLFYLAPLPLMVAALGWGAIGAAVGGLLGAAGLAAIFNFSYAIAFVVTVVAPAYWLGHLAMLARPSDTTDAAPPALEWYPVGRIVAWIAGFAALTTMAALLTLGTDSATISEGLRAGLQRTLGSRNPGDADRLIEALVAVAPPAAATVAMLTLTLNLWLAAKITATSGRLNRPWPDLRTATLPAMTLAVLSLALGLSFAGGLAALIGSIVSATLLIAYGLIGAATLHTLTMAARHRGFLLSSTYALVLIFLWPALGLIALGIGDAVFGFRQRYFQRRSMPPPTTT GT:EXON 1|1-315:0| TM:NTM 7 TM:REGION 24->46| TM:REGION 74->96| TM:REGION 113->135| TM:REGION 168->190| TM:REGION 209->231| TM:REGION 237->259| TM:REGION 273->295| SEG 20->40|asiisgalislllfylaplpl| SEG 43->65|aalgwgaigaavggllgaaglaa| SEG 122->135|aalttmaalltlgt| SEG 166->185|alvavappaaatvamltltl| SEG 217->238|lavlslalglsfagglaaligs| HM:PFM:NREP 1 HM:PFM:REP 17->294|PF09991|0.0004|21.4|276/290|DUF2232| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------1--1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,306-309,311-316| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHEEEHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccc //