[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40218.1
DDBJ      :             alanine racemase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  827/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.49.2c.1.6
:409 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->392 3b8wA PDBj 5e-39 31.6 %
:RPS:PDB   35->392 2dy3B PDBj 3e-47 28.2 %
:RPS:SCOP  38->262 1rcqA2  c.1.6.1 * 2e-25 27.7 %
:RPS:SCOP  260->395 1rcqA1  b.49.2.2 * 2e-40 41.4 %
:HMM:SCOP  38->263 1rcqA2 c.1.6.1 * 3.5e-54 36.2 %
:HMM:SCOP  247->406 1bd0A1 b.49.2.2 * 3.2e-49 48.3 %
:RPS:PFM   262->392 PF00842 * Ala_racemase_C 3e-25 54.8 %
:HMM:PFM   262->392 PF00842 * Ala_racemase_C 1.3e-45 52.0 125/129  
:HMM:PFM   38->251 PF01168 * Ala_racemase_N 1.3e-40 33.5 206/214  
:BLT:SWISS 36->397 ALR_METNO 8e-85 45.9 %
:PROS 61->71|PS00395|ALANINE_RACEMASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40218.1 GT:GENE ABE40218.1 GT:PRODUCT alanine racemase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3332532..3333761 GB:FROM 3332532 GB:TO 3333761 GB:DIRECTION + GB:PRODUCT alanine racemase GB:PROTEIN_ID ABE40218.1 GB:DB_XREF GI:91683916 InterPro:IPR000821 InterPro:IPR001608 InterPro:IPR011079 LENGTH 409 SQ:AASEQ MNILPDPNATVASLLTPEAAKAAALAAATATAPGVLTVDLDAIVANWRKIEKTAVPAEAAAVVKGDAYGCGIGPVSKALAAAGCKTFFVATLGEAGAVRAIAPDAVIYVLDGFFQTTGDEFARLNCRPVIGDLYELAEWDVYCRRTRWSGGAAIHIDTGMNRLGLTVAEAQGIVPRIAAGDHGITLVISHLAAAEALNHPMNARQVTAFREIASLFTGVAASLSASSGVFLGPQFAFDMVRPGAALYGINPTPEADNPMKPVVDLKARIVQVRSVERGDSVGYGGTWTARRPTRIAVLSAGYADGYFRAAGSNDGTRGADVVIAGQRCPIAGRVSMDLLAVDVTDLPANAARRGLMATLIGDGITVDELGHHFGTIGYEVLTSLGARYARIYSGGDAKPEETPAEQSGA GT:EXON 1|1-409:0| BL:SWS:NREP 1 BL:SWS:REP 36->397|ALR_METNO|8e-85|45.9|357/370| PROS 61->71|PS00395|ALANINE_RACEMASE|PDOC00332| SEG 12->32|aslltpeaakaaalaaatata| SEG 220->227|aaslsass| BL:PDB:NREP 1 BL:PDB:REP 36->392|3b8wA|5e-39|31.6|345/358| RP:PDB:NREP 1 RP:PDB:REP 35->392|2dy3B|3e-47|28.2|333/340| RP:PFM:NREP 1 RP:PFM:REP 262->392|PF00842|3e-25|54.8|124/127|Ala_racemase_C| HM:PFM:NREP 2 HM:PFM:REP 262->392|PF00842|1.3e-45|52.0|125/129|Ala_racemase_C| HM:PFM:REP 38->251|PF01168|1.3e-40|33.5|206/214|Ala_racemase_N| GO:PFM:NREP 2 GO:PFM GO:0006522|"GO:alanine metabolic process"|PF00842|IPR011079| GO:PFM GO:0008784|"GO:alanine racemase activity"|PF00842|IPR011079| RP:SCP:NREP 2 RP:SCP:REP 38->262|1rcqA2|2e-25|27.7|220/226|c.1.6.1| RP:SCP:REP 260->395|1rcqA1|2e-40|41.4|128/131|b.49.2.2| HM:SCP:REP 38->263|1rcqA2|3.5e-54|36.2|221/0|c.1.6.1|1/1|PLP-binding barrel| HM:SCP:REP 247->406|1bd0A1|3.2e-49|48.3|145/149|b.49.2.2|1/1|Alanine racemase C-terminal domain-like| OP:NHOMO 1066 OP:NHOMOORG 838 OP:PATTERN --------------------------------------11111------------------------- 1111111111111111111-11111111111111111111111111111221212112--112111111111111111111111111111111111---11111111111--------------11111111111111111---111111111111111111111111111111111111111111111111122222222222222221122222231111221111111322111111111111111111111111111111111111111232111111111111111111111111111111111111111111111111112233322331211211111111111111212211121112112111211-1111111112-1111111112111111111111-1111111223112223222222112112111111111111111111112231111------------1111111111111-----1121112221222222211112211222212231121111111111111111111111111211111111111111111111111121111111111111111111111-1-111111-1111111111111111332111111121111111211111111111--11111------22111212222222222-22222222222222222232221122322332232222323322111222211222122212222--1111111111111111111111111111111222321211111222211112222111111111111111122322222131221111111111111111111111111111111111--------------------------11111-----112 -------------------------------------------------------------------------------------------------------------1-----------------------------------------------------31---------------------------111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 364 STR:RPRED 89.0 SQ:SECSTR ################################ccEEEEcHHHHHHHHHHHHHHHTTcEEEEEcHHHHHTTcHHHHHHHHHTTTccEEEEEEHHHHHHHHHTTcccEEEEEEccTTccHHHHHTTTcEEEEccHHHHHHHHHHHTcccccEEEEEEcccccccccccHHHHHHHHHHHHHcTTEEEEEEcccccccHHHHHHHHHHHHHHHHHHTTccccccccccHHHHTTcGGGcTTEEcccGGGGTccccTTccccccccEEEEEEccEEEEccTTcEEcGGGcEEcccccEEEEEcccGGGTccGGGTTTcccTTcEEEETTEEEEEEcccccccEEEEEETcTTTcccTTcEEEEEcTcccHHHHHHHTTccHHHHHHcccTTcEEEEcETT############# DISOP:02AL 1-1,400-410| PSIPRED cccccccccHHHHHccHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHccccEEEEccHHHHHHHHHccccccEEEEEccccHHHHHHHHcccEEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHcccHHcccEEEEEEEEEcccccccccccccEEEEEEEEEEEEEEEccccEEccccEEEcccccEEEEEEcccccccccccccccccccEEEEEccEEEEEEcccccccEEEEcccccccccccccEEEEEcccccHHHHHHHHcccHHHHHccccccccEEEccccccccccccccccc //