[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40227.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->82 1c7iA PDBj 7e-04 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40227.1 GT:GENE ABE40227.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 3342311..3342589 GB:FROM 3342311 GB:TO 3342589 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE40227.1 GB:DB_XREF GI:91683925 LENGTH 92 SQ:AASEQ MKPEDFEPWVGRAVRVATVPEPVELTLIRLQRKPLFIGAEREPFSLFFEAPDDVYLLDAAYEFDCGRGGPYTILISQLQPRNGRRRYQAVFN GT:EXON 1|1-92:0| BL:PDB:NREP 1 BL:PDB:REP 2->82|1c7iA|7e-04|34.2|79/483| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 85.9 SQ:SECSTR #TccTTcccccccccTTTccccHHHHHHTTTTTcEEEEEETTGGGGTccTTccccHHHHHHHHHHHH##HHHHHHHTTcccc########## DISOP:02AL 1-3,86-88,92-93| PSIPRED ccccccccccccEEEEEEccccEEEEEEEEEcccEEEEcccccEEEEEEccccEEEEEEEEEEcccccccEEEEEEEcccccccEEEHHHcc //