[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE40231.1
DDBJ      :             Small GTP-binding protein domain
Swiss-Prot:ENGA_RHOPS   RecName: Full=GTP-binding protein engA;

Homologs  Archaea  1/68 : Bacteria  908/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
b.34.4c.37.1d.52.5
:460 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->441 1mkyA PDBj 2e-41 35.2 %
:RPS:PDB   6->159 3a1tA PDBj 2e-19 24.2 %
:RPS:PDB   189->455 3a1vB PDBj 3e-29 18.4 %
:RPS:SCOP  4->26 2cxxA1  c.37.1.8 * 2e-05 60.9 %
:RPS:SCOP  54->286 1ahjB  b.34.4.4 * 2e-22 12.0 %
:RPS:SCOP  266->358 1g7rA4  c.37.1.8 * 2e-07 22.6 %
:RPS:SCOP  366->448 1mkyA3  d.52.5.1 * 2e-21 24.1 %
:HMM:SCOP  1->175 1jalA1 c.37.1.8 * 2.7e-45 39.5 %
:HMM:SCOP  138->453 1f5nA2 c.37.1.8 * 2.2e-68 38.1 %
:RPS:PFM   4->162 PF02421 * FeoB_N 1e-07 31.3 %
:RPS:PFM   189->358 PF02421 * FeoB_N 1e-10 30.4 %
:HMM:PFM   14->120 PF01926 * MMR_HSR1 1.7e-25 44.3 106/108  
:HMM:PFM   200->308 PF01926 * MMR_HSR1 2.1e-23 31.1 106/108  
:HMM:PFM   182->209 PF01580 * FtsK_SpoIIIE 6.5e-05 40.7 27/205  
:BLT:SWISS 1->460 ENGA_RHOPS 0.0 100.0 %
:REPEAT 2|6->160|192->357
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE40231.1 GT:GENE ABE40231.1 GT:PRODUCT Small GTP-binding protein domain GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(3350153..3351535) GB:FROM 3350153 GB:TO 3351535 GB:DIRECTION - GB:PRODUCT Small GTP-binding protein domain GB:PROTEIN_ID ABE40231.1 GB:DB_XREF GI:91683929 InterPro:IPR002917 InterPro:IPR005225 InterPro:IPR005289 InterPro:IPR006073 LENGTH 460 SQ:AASEQ MSFTFAIIGRPNVGKSTLFNRLVGQKLALVDDTPGVTRDRREGEGRLGDLEFTIIDTAGLDEGAKGSLTARMQQQTETAIELADALMFVFDARAGLTPNDRAFADFARRANKPVVLVANKSEGKAGEIGAMESYALGLGDPVQISAEHGEGLSELYDALRALMPEPDVELEDDEEIDGLTEEDFSKRPIRVAIVGRPNAGKSTFINRLLGEDRLLTSPEAGTTRDSIAVEVNWKGRDFRIFDTAGLRRRSRIEEKLEKLSVADALRAVRFAEVVVLMMDSQNRFEEQDLRIADLIEREGRALVIAVNKWDLVERQGGQIAQLRTDADHWLPQIKGVPIVATSGMLGEGVDRMMEAIQDAYAVWNTRVPTAALNRWFEQAVAQNPPPAVAGRRLKLNYVTQTKARPPSFVVFCSRADAVPQSYLRYLVNSLRGVFELPGTPVRIMLREKANPFAHKRKRKS GT:EXON 1|1-460:0| SW:ID ENGA_RHOPS SW:DE RecName: Full=GTP-binding protein engA; SW:GN Name=engA; OrderedLocusNames=RPD_3005; SW:KW Complete proteome; GTP-binding; Nucleotide-binding; Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->460|ENGA_RHOPS|0.0|100.0|460/460| GO:SWS:NREP 2 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| NREPEAT 1 REPEAT 2|6->160|192->357| SEG 38->51|rdrregegrlgdle| SEG 100->110|drafadfarra| SEG 165->183|epdveleddeeidglteed| SEG 378->389|qavaqnpppava| BL:PDB:NREP 1 BL:PDB:REP 4->441|1mkyA|2e-41|35.2|384/400| RP:PDB:NREP 2 RP:PDB:REP 6->159|3a1tA|2e-19|24.2|150/254| RP:PDB:REP 189->455|3a1vB|3e-29|18.4|239/245| RP:PFM:NREP 2 RP:PFM:REP 4->162|PF02421|1e-07|31.3|154/188|FeoB_N| RP:PFM:REP 189->358|PF02421|1e-10|30.4|158/188|FeoB_N| HM:PFM:NREP 3 HM:PFM:REP 14->120|PF01926|1.7e-25|44.3|106/108|MMR_HSR1| HM:PFM:REP 200->308|PF01926|2.1e-23|31.1|106/108|MMR_HSR1| HM:PFM:REP 182->209|PF01580|6.5e-05|40.7|27/205|FtsK_SpoIIIE| GO:PFM:NREP 8 GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 4 RP:SCP:REP 4->26|2cxxA1|2e-05|60.9|23/184|c.37.1.8| RP:SCP:REP 54->286|1ahjB|2e-22|12.0|200/212|b.34.4.4| RP:SCP:REP 266->358|1g7rA4|2e-07|22.6|93/212|c.37.1.8| RP:SCP:REP 366->448|1mkyA3|2e-21|24.1|79/81|d.52.5.1| HM:SCP:REP 1->175|1jalA1|2.7e-45|39.5|172/0|c.37.1.8|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 138->453|1f5nA2|2.2e-68|38.1|270/0|c.37.1.8|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2284 OP:NHOMOORG 990 OP:PATTERN ----------------------------------1--------------------------------- 2331111111111111111-1111111111111111111111111121111121211111111111111111-111111121232333232322222222222223222312222221111111224231322222333331113133333322333232223333322232233322223332333333133333333333333333333333333333333333333332333333332233333333322323333333233333333322222223333333333333333333333333333333333333333333333322222222222233333222332223333422443233333333333243323122323223312333333322222222222-211211312131222211211122222112122222222222222223333232222232223213333333332333322122-2133322222333433233333333333333333333222332332222323222233222332222233232333223233332232222233234332222231332222222222222222222222323223233233322322222222222222222222-2213121122233333333333333333-33333333333333333333332233333332233223333333333333332322222222222222233333121132332222323233223333333333322232333333333333333332322233233222322222333331112122112333322322222222222222222323223-22322222222212221113334233333122 11--11-1311----1-1--1--1111-------------------11-11------1-1-111---111-1--111-111--1-1-1--21---------11-1--142-1----1---------------------1--------------------13--211----1111-2432E3325532241442252322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 460 STR:RPRED 100.0 SQ:SECSTR ccEEEccccHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccGGGccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHGGGccccccccTTcTTcccccccccccEEEEEEccTTccHHHHHHHHHTTcccEEEccTTTcccEEEccEEETTEEEEEEEccccccccccccccHHHHHHHHHHHHccccEEEEEccTTcHHcHHHHHHHHHHHTTcccEEEEcccTTcccHTTccccHEEEccHHHHHHHHcccEEcccTTTcccHHHHHHHHHHHHHcccccccccccccHHTHHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHcccETTcTTHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 448-461| PSIPRED ccEEEEEEccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEEEccccEEccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccHHccccccccccccccEEEEEccccccHHHHHHHHHcccEEEEccccccEEEEEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEEEEEccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHccc //