[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67711.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->65 2bhrA PDBj 6e-07 25.4 %
:RPS:SCOP  3->65 1pjrA1  c.37.1.19 * 2e-05 15.9 %
:HMM:SCOP  4->58 1rifA_ c.37.1.23 * 1.3e-06 33.3 %
:HMM:PFM   6->53 PF04851 * ResIII 1.5e-11 39.1 46/184  
:BLT:SWISS 14->60 MFH2_SCHPO 8e-04 46.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67711.1 GT:GENE BAC67711.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2466..2699 GB:FROM 2466 GB:TO 2699 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF04851: Type III restriction enzyme, res subunit GB:PROTEIN_ID BAC67711.1 LENGTH 77 SQ:AASEQ MPPQGARGTIVSATGSGKTSMAAASTLNCFPEGRILVTVPTLDLLAQTAQAWRAVGHHSPMIAVCSLENDPVLNERT GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 14->60|MFH2_SCHPO|8e-04|46.8|47/100| RP:PDB:NREP 1 RP:PDB:REP 7->65|2bhrA|6e-07|25.4|59/431| HM:PFM:NREP 1 HM:PFM:REP 6->53|PF04851|1.5e-11|39.1|46/184|ResIII| RP:SCP:NREP 1 RP:SCP:REP 3->65|1pjrA1|2e-05|15.9|63/315|c.37.1.19| HM:SCP:REP 4->58|1rifA_|1.3e-06|33.3|54/282|c.37.1.23|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------42------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 84.4 SQ:SECSTR ###ccccEEEEEcTTccTTTTHHHHHHHHHHTccEEEEEccHHHHHHHHHTTTTccEEEccccEEHHH######### DISOP:02AL 1-4, 73-77| PSIPRED ccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEEccccccccccc //