[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67713.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:168 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->61 PF11203 * DUF2984 0.00047 27.1 48/98  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67713.1 GT:GENE BAC67713.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(3433..3939) GB:FROM 3433 GB:TO 3939 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67713.1 LENGTH 168 SQ:AASEQ MALTPGGTRVTQWQDRQAIGDMHERRVAAALRARGWTVQPCGQGTYPPAVREALRRTRSALRHFPDLIAARGADLITIDAKDRMPSTDTDRYAVSADTVTAGLFFTAAHAPTPLYYVFGDLKVLTPAEVVHYTAHALRHRSGAFHLVRTEQAHCFDDVFGSAGAAAAA GT:EXON 1|1-168:0| SEG 162->167|agaaaa| HM:PFM:NREP 1 HM:PFM:REP 14->61|PF11203|0.00047|27.1|48/98|DUF2984| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 167-168| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEccHHHHHHHEEEccccccEEEEEccEEEEcHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHccccccccc //