[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67717.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->84 PF10571 * UPF0547 0.00037 40.0 15/26  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67717.1 GT:GENE BAC67717.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(9886..10635) GB:FROM 9886 GB:TO 10635 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01754: A20-like zinc finger GB:PROTEIN_ID BAC67717.1 LENGTH 249 SQ:AASEQ MSSISSALSRLPAPRAENAGDLDGGGWAAWLRGHLDPAWRTSEWRQDCWLFTGSVHEPRSSVALCRTEACDTVVSPANIFCPFCKEEQKRSPLPDAEFARAFVPVRNRVAFGGVPEPCSFTKDGQRCVRPRHCKELCATHYTQWKTHSTRKTAGRWEDTAVPYADTPACPAPACPLPGLYGRGLCRHHAQRWMAFLIRSLSSLRVRISCLASSSSVRSVAVVLRVRAGEGVVGCWRCCAASMCSRMPSA GT:EXON 1|1-249:0| SEG 19->31|agdldgggwaawl| SEG 162->181|pyadtpacpapacplpglyg| SEG 196->227|lirslsslrvrisclassssvrsvavvlrvra| HM:PFM:NREP 1 HM:PFM:REP 70->84|PF10571|0.00037|40.0|15/26|UPF0547| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 89-91, 248-249| PSIPRED ccHHHHHHHHcccccccccccccccHHHHHHHHccccccccHHHHHHHEEEEccccccHHHHHHHHHHHHHHHcccHHHHcccHHHHHHccccccHHHHHHHHHHHHcEEEccccccccccccHHHHccHHHHHHHHHHHHHHHHccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHEEEcccccHHHHHHHHHHHHHHHcccc //