[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67718.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.163.1
:57 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->53 2a3vB PDBj 2e-04 38.5 %
:RPS:PDB   2->48 1aihA PDBj 6e-07 29.8 %
:RPS:SCOP  1->48 1aihA  d.163.1.1 * 3e-09 29.2 %
:HMM:SCOP  1->48 1a0pA2 d.163.1.1 * 1.3e-11 52.1 %
:RPS:PFM   2->42 PF00589 * Phage_integrase 5e-05 53.7 %
:HMM:PFM   1->41 PF00589 * Phage_integrase 6.1e-14 51.2 41/173  
:BLT:SWISS 2->49 XERC_MYCTU 3e-08 54.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67718.1 GT:GENE BAC67718.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(10632..10805) GB:FROM 10632 GB:TO 10805 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67718.1 LENGTH 57 SQ:AASEQ MLRHSAATRWLRDGVDRDVVQRLLGHASPLSMERYRHVNDAEARAAVERVGSLKERR GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 2->49|XERC_MYCTU|3e-08|54.2|48/298| BL:PDB:NREP 1 BL:PDB:REP 2->53|2a3vB|2e-04|38.5|52/320| RP:PDB:NREP 1 RP:PDB:REP 2->48|1aihA|6e-07|29.8|47/170| RP:PFM:NREP 1 RP:PFM:REP 2->42|PF00589|5e-05|53.7|41/168|Phage_integrase| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF00589|6.1e-14|51.2|41/173|Phage_integrase| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 1 RP:SCP:REP 1->48|1aihA|3e-09|29.2|48/170|d.163.1.1| HM:SCP:REP 1->48|1a0pA2|1.3e-11|52.1|48/182|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 93.0 SQ:SECSTR HHHHHHHHHHHHTTccHHHHHHHHTcccHHHHGGGGGGccccTTHHHHGcGTc#### DISOP:02AL 54-57| PSIPRED ccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHccc //