[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67726.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->44 PF09955 * DUF2189 0.0003 30.8 26/128  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67726.1 GT:GENE BAC67726.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 23457..23621 GB:FROM 23457 GB:TO 23621 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67726.1 LENGTH 54 SQ:AASEQ MNSAPRTRCPQALRDRRAAVLFVAFFAVVFLADCCFAVFFFGSSWTPASTPREA GT:EXON 1|1-54:0| TM:NTM 1 TM:REGION 21->42| SEG 12->41|alrdrraavlfvaffavvfladccfavfff| HM:PFM:NREP 1 HM:PFM:REP 18->44|PF09955|0.0003|30.8|26/128|DUF2189| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 49-54| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //