[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67728.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   94->129 PF01073 * 3Beta_HSD 2.9e-05 37.1 35/280  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67728.1 GT:GENE BAC67728.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(24570..24983) GB:FROM 24570 GB:TO 24983 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67728.1 LENGTH 137 SQ:AASEQ MNEGGRMSRDTAVAEVGMRGITFPAWHGEHYVTLAEVLVRLGSFGLDLTWRIEFDEIVDPRCVEMERRSADAGMDTLTLLSLTTPFLQLIDAEARGFAGDELVLVLTEFDSSSWDVRAVDKRVLSELRQHYPGAEDL GT:EXON 1|1-137:0| SEG 76->89|tltllslttpflql| HM:PFM:NREP 1 HM:PFM:REP 94->129|PF01073|2.9e-05|37.1|35/280|3Beta_HSD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 133-137| PSIPRED ccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccEEEEEEHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHccccccc //