[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67729.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67729.1 GT:GENE BAC67729.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(25166..25690) GB:FROM 25166 GB:TO 25690 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67729.1 LENGTH 174 SQ:AASEQ MNEIMLSLAGAELPSVLPDDVPAAYRAIAEEGWTVDGNGAYLLSALQAGYHGSTAGEFEDIVHFEATVNGRGMMDYDLPASGPERQNRLLRRSIAYACLALQAAPAESEHPLLGYVSLSEGGLSDDTLTANVTFCTRRSGIPPYVSDIQDYSEESLLELSRDDAVNALKGADGR GT:EXON 1|1-174:0| SEG 95->106|ayaclalqaapa| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 171-174| PSIPRED cccEEEEEccccccccccccHHHHHHHHHHcccEEccccHHHHHHHHccccccccccHHHHEEEEEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccccEEEEEEEEEEccccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccc //