[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67731.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->96 2cg3A PDBj 5e-05 18.5 %
:HMM:PFM   35->96 PF05565 * Sipho_Gp157 0.00038 22.6 62/162  
:BLT:SWISS 30->137 EBH_STAES 7e-04 24.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67731.1 GT:GENE BAC67731.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(29508..30080) GB:FROM 29508 GB:TO 30080 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05565: Siphovirus Gp157 GB:PROTEIN_ID BAC67731.1 LENGTH 190 SQ:AASEQ MSSGLRKVDSSGWQGEGGEAFREKFGVHPTKWAQAAEACNTAAGALELYADTLKWAQGQAKEAVELYKKGVKASQDAVDAYNKKVDAYNAKIKANEDPGPKPEPFHDPGKADIKAAAQKLAEARKQRNTAASEAQGKIKAALAHAPAEPPPLDRIGNDLKDGFQAANTELTHVVGGALKGTAGLVTSPPA GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 30->137|EBH_STAES|7e-04|24.0|104/9439| COIL:NAA 66 COIL:NSEG 2 COIL:REGION 58->97| COIL:REGION 112->137| SEG 140->152|aalahapaepppl| RP:PDB:NREP 1 RP:PDB:REP 31->96|2cg3A|5e-05|18.5|65/617| HM:PFM:NREP 1 HM:PFM:REP 35->96|PF05565|0.00038|22.6|62/162|Sipho_Gp157| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 34.2 SQ:SECSTR ##############################cHHHHHHHHHHHHHHHHHHHHHH#HHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHcHH############################################################################################## DISOP:02AL 1-12, 92-105, 119-137, 189-190| PSIPRED ccccccHHcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccc //