[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67732.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->39 PF02987 * LEA_4 0.00031 33.3 21/44  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67732.1 GT:GENE BAC67732.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(30107..30394) GB:FROM 30107 GB:TO 30394 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67732.1 LENGTH 95 SQ:AASEQ MGLGDVTNSLLGGAENLYDAGKKKLGEGVDWATDKVGEGLDKVGAHDWADSVEDWGDEIASDLGPPRVSSSSARPRSPTNSSTAIRTRSARVPST GT:EXON 1|1-95:0| SEG 65->82|pprvssssarprsptnss| HM:PFM:NREP 1 HM:PFM:REP 19->39|PF02987|0.00031|33.3|21/44|LEA_4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 65-86, 91-95| PSIPRED cccHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHcHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccccccc //