[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67736.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->48 PF04955 * HupE_UreJ 0.00097 25.6 43/180  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67736.1 GT:GENE BAC67736.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(33121..33411) GB:FROM 33121 GB:TO 33411 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67736.1 LENGTH 96 SQ:AASEQ MMRGSGCAAETEMGGTMDPVTFTAGCGVATSAVRLGYVWLSAWSHRRRVELEIHRAELERATLMETISSLPPGSEVTEVLRDGRRVTIKLPPSKAA GT:EXON 1|1-96:0| TM:NTM 1 TM:REGION 22->43| HM:PFM:NREP 1 HM:PFM:REP 6->48|PF04955|0.00097|25.6|43/180|HupE_UreJ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 94-96| PSIPRED cccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHcccccHHHHHHHHcccEEEEEccccccc //