[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67738.1
DDBJ      :             putative PadR-like family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->85 3f8fB PDBj 4e-10 36.6 %
:RPS:PDB   1->83 2co5B PDBj 6e-09 15.8 %
:RPS:SCOP  12->87 1yg2A  a.4.5.61 * 2e-09 26.9 %
:HMM:SCOP  4->106 1xmaA_ a.4.5.61 * 7.3e-22 38.8 %
:RPS:PFM   15->87 PF03551 * PadR 2e-11 49.3 %
:HMM:PFM   12->88 PF03551 * PadR 6.5e-24 44.2 77/86  
:BLT:SWISS 10->105 YT37_STRFR 6e-11 46.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67738.1 GT:GENE BAC67738.1 GT:PRODUCT putative PadR-like family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 37315..37656 GB:FROM 37315 GB:TO 37656 GB:DIRECTION + GB:PRODUCT putative PadR-like family transcriptional regulator GB:NOTE PF03551: Transcriptional regulator PadR-like family GB:PROTEIN_ID BAC67738.1 LENGTH 113 SQ:AASEQ MTRRNPPLTEPQYFILAALMDGPLHGYGIIKAAEQATDGRLRIAVGTLYGALERMERAGLVAAGHEEIVDGRARRYYRLTEDGTEALGREALRMQQAAAVVIGRARDAGAAPA GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 10->105|YT37_STRFR|6e-11|46.7|90/345| BL:PDB:NREP 1 BL:PDB:REP 15->85|3f8fB|4e-10|36.6|71/111| RP:PDB:NREP 1 RP:PDB:REP 1->83|2co5B|6e-09|15.8|76/94| RP:PFM:NREP 1 RP:PFM:REP 15->87|PF03551|2e-11|49.3|73/84|PadR| HM:PFM:NREP 1 HM:PFM:REP 12->88|PF03551|6.5e-24|44.2|77/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 12->87|1yg2A|2e-09|26.9|67/169|a.4.5.61| HM:SCP:REP 4->106|1xmaA_|7.3e-22|38.8|103/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 110 OP:NHOMOORG 67 OP:PATTERN ---------------------------------------------1---------------------- 32G-2--------------------------------------3-1---1----------2---1-11----------1-2---------------------------------------------------------------1---------------------3------------------3-------122222222-321122--11--222---1--11111---1----------------------------------------------111----1--------------------------111---111---1--111--11---1---------1--------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 89.4 SQ:SECSTR ccccTTcHHHHHHHHHHHHTTTEEEGGGHHHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEEcEEEccTTccEEEEcHHHcHHHHHHHHHHHHHHHHT############ DISOP:02AL 66-71, 111-113| PSIPRED cccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccEEEccccHHHHHHHHHHHcccEEEEEEEccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //