[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67741.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:200 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 114->171 ASNA_TREPS 1e-04 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67741.1 GT:GENE BAC67741.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 41010..41612 GB:FROM 41010 GB:TO 41612 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67741.1 LENGTH 200 SQ:AASEQ MLRGRRPRPARRSISRSGIAPARWYISRSAARSSAAFSTSRKGALMAELVRQQHLDADVGYHGFGFQESDDGDILAPFPDDFADEVFLNAFPGRLDIYSAGHTHTASVTVAVWDGPPAAHDRVQWDEQAEADYDSASGEVAVWSMSLGRADEVITLADSGGLWRVRVSCTGRAVAARLSEEEGTGHGVEKYLVQFWPRTA GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 114->171|ASNA_TREPS|1e-04|40.4|57/330| SEG 3->23|rgrrprparrsisrsgiapar| SEG 27->41|srsaarssaafstsr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 34-37| PSIPRED ccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccEEccccccHHHHHHHHccccEEEEEEcccEEEEEEEEEEEccccccccccccccHHccccccccccEEEEEEcccccccEEEEEccccEEEEEEEEccHHHHHHHcccccccccHHHHHHHHccccc //