[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67743.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:678 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  88->118 2b7oA1  c.1.10.8 * 1e-04 46.4 %
:RPS:PFM   105->267 PF09126 * NaeI 3e-04 28.6 %
:BLT:SWISS 81->248 MUC16_HUMAN 3e-04 30.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67743.1 GT:GENE BAC67743.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 42010..44046 GB:FROM 42010 GB:TO 44046 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67743.1 LENGTH 678 SQ:AASEQ MGFVHLFPQRGRRLISLTARTTGRRRLALGTILAIVIGSGATGTAYSADGSDNPPPVHGPGARAAAAAEPDTPNGPEVGPPFTKTNNVWQTDTTTPTLRNTVTAPSGHKTTATFEVHTTDSSGKPTATVVKLTDENQWGVLVSGEVTAGKPASVTVPAGKLKNGVTYAVRSSGYDATSNVYESDWSPYSTFKINVPPAEKPYVTFPAPQATSGIDSLAQTPIEFTRTDPGPVTGLRGDDNGRKCSAPDAEGRKVCIEISRDAPTPEDAAVAKGAMRQALRGADLVSWCAAKPDGKDYMNRGEACLKKVGYATLIFVDADDLPRFGTATFALSQQIKLYNKKSDTGTDRAEFDQQLTVVPTQIDDATEGVHLTWQPGDNCKDCTSSQVQWSSNDGLNTTPHWAVGEVGAQYAMTAKRQTIWNGTGKEQFDLGWSLLGSVDAGNAHAQTSLGTSGDVRVRELAPRCDDIAGGNIKTGCVFPYFKPTWTVDTNLYPAAGAYYWLLQEKLPSHPGSRKWDSLVTYLGPGNNADPDGGDWTNDDSRGIVCPTGTSGFKPNPATPDGSCDEYAPASTYQSGGMPKGPNQVASGKECAQLYTKPMTGGTWGLLAENRDGYTGPKWNEKCGRASVPTDQNTGAFRDLGIKFVPQMRLLDKDGFFISDPGFEHCKNADTVCAWKKVG GT:EXON 1|1-678:0| BL:SWS:NREP 1 BL:SWS:REP 81->248|MUC16_HUMAN|3e-04|30.3|152/22152| SEG 17->35|ltarttgrrrlalgtilai| SEG 54->75|pppvhgpgaraaaaaepdtpng| SEG 523->534|gpgnnadpdggd| RP:PFM:NREP 1 RP:PFM:REP 105->267|PF09126|3e-04|28.6|140/290|NaeI| RP:SCP:NREP 1 RP:SCP:REP 88->118|2b7oA1|1e-04|46.4|28/449|c.1.10.8| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-56, 62-79, 239-242, 270-273, 573-585| PSIPRED ccEEEEccccccEEEEEEEcccccHHHHHHHEEEHEEcccccccEEEcccccccccccccccHHHccccccccccccccccccccccEEEEEcccEEEEEEEEccccccEEEEEEEEEccccccHHHHHHHHHcccccEEEEccEEEccccEEEEEcHHHEEcccEEEEEEcccccccccEEccccccEEEEEEcccccccEEEEccccccccccHHHccccccEEccccccccccccccHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHccccccccccHHHcccEEEEEEcccccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHccccHHHcccccccccHHHHHHHHcccccHHHHHHHHHccccccEEHHccccccccccccccccEEEEcccccEEEccccccHHHHHHHHHHHHcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEEEEcccccccccHHHHcccccccccccHHHHHHHHHHHHHHHEEEEcccEEEccccHHHHcccccEEEEEccc //