[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67744.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   93->248 3d5pA PDBj 2e-11 18.9 %
:HMM:PFM   96->234 PF09346 * SMI1_KNR4 4.6e-08 20.3 128/130  
:BLT:SWISS 32->114 SMI1_YARLI 1e-07 28.9 %
:PROS 158->168|PS00133|CARBOXYPEPT_ZN_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67744.1 GT:GENE BAC67744.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(44107..44958) GB:FROM 44107 GB:TO 44958 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67744.1 LENGTH 283 SQ:AASEQ MSGFVRTGACACSPSPSASPTCSTTSSSGRHAPMSPPPFCAGGEVREVAGARHETRRVAGMTDDQQQEQAVAGAWARIEEWLERHAPRSYRMLPPPAPEADIREVEQELDLTVPPGLKAFYRLRNGTGHPGDFGWTPEPDTGLPLQGQETAWLLPRKHGIPPVQHLPYWDEGPHTIGRPDDPMVRYLAFAATDRSGLYGLFTDCTPGTGYGRIGTFEEAGIPKLGVWSSFADYLIEVADALYENRGVEYADGHQDTKVPGLVDQALVWDGPAHPRDPEWTRFA GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 32->114|SMI1_YARLI|1e-07|28.9|83/713| PROS 158->168|PS00133|CARBOXYPEPT_ZN_2|PDOC00123| SEG 9->28|acacspspsasptcsttsss| RP:PDB:NREP 1 RP:PDB:REP 93->248|3d5pA|2e-11|18.9|122/131| HM:PFM:NREP 1 HM:PFM:REP 96->234|PF09346|4.6e-08|20.3|128/130|SMI1_KNR4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 43.1 SQ:SECSTR ############################################################################################EcccccHHHHHHHHHHHTccccHHHHHHHHHccc####EEEEETTEE##################EEEccHHHHHHHHHHHTHHHHccTTE#####EEEEETTEEEEEETTT###ccEEEEETTcccGGGcEEEEccHHHHH####HHHTTccTTc################################### DISOP:02AL 1-2, 12-70, 277-278| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEEcccccccHHHccccccccccccccccHHHHHHHHHHccccccEEEEEcccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccccccc //