[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67745.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67745.1 GT:GENE BAC67745.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(45160..45432) GB:FROM 45160 GB:TO 45432 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67745.1 LENGTH 90 SQ:AASEQ MNKTIAWLLTCAGAGVILWLLTSAPDISSAYPRSECHSVLGNDSSPAHGSMEDGVEATCATYQSRRLGWAVLVSVPTVVLASAGMRSRSA GT:EXON 1|1-90:0| TM:NTM 2 TM:REGION 2->24| TM:REGION 67->86| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 42-50, 87-90| PSIPRED cccHHHHHHHHHcHHHHHHHHHccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccc //