[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67748.1
DDBJ      :             putative terminal protein Tpg homolog
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 5->66 DXS_MARMM 6e-04 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67748.1 GT:GENE BAC67748.1 GT:PRODUCT putative terminal protein Tpg homolog GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 49166..49456 GB:FROM 49166 GB:TO 49456 GB:DIRECTION + GB:PRODUCT putative terminal protein Tpg homolog GB:NOTE probably pseudogene GB:PROTEIN_ID BAC67748.1 LENGTH 96 SQ:AASEQ MPGPKRKASASTSERASGSRLWRGSSDDPRVRWATQSLPGEAARELFAVRDVGAGEQQLVILARALGHAYFRDGGRRGHRLHIAFTDIEFAGFSTG GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 5->66|DXS_MARMM|6e-04|37.1|62/100| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccccHHEEcccEEEccccccccccEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccccc //